Result : Q8DY91
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0154 protein SAG1601 |
| NCBI Accession ID | AE009948.1 |
| Organism | Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) |
| Left | 1604093 |
| Right | 1604332 |
| Strand | - |
| Nucleotide Sequence | ATGTCAATAACTATTTGGATTTTATTAATTATCGTCGCTTTGTTTGGTGGTCTCGTGGGAGGCATTTTTATTGCTCGTAAACAAATTGAAAAAGAGATTGGAGAGCACCCTCGTTTAACACCGGATGCTATTCGTGAAATGATGAGTCAAATGGGACAAAAACCTAGTGAAGCTAAAGTTCAACAAACATACCGTAATATTGTAAAACACGCAAAAACAGCTATCAAAACTAAAAAATAA |
| Sequence | MSITIWILLIIVALFGGLVGGIFIARKQIEKEIGEHPRLTPDAIREMMSQMGQKPSEAKVQQTYRNIVKHAKTAIKTKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23791. Profile Description: Uncharacterized protein family (UPF0154). hypothetical protein; Provisional |
| Pubmed ID | 12200547 |
| Domain | CDD:420010 |
| Functional Category | Others |
| Uniprot ID | Q8DY91 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1533592 | 1533831 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 2 | 334819 | 335061 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 3 | 1407426 | 1407668 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 4 | 302699 | 302941 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 5 | 430942 | 431184 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 6 | 149348 | 149590 | - | NZ_LR134293.1 | Streptococcus canis |
| 7 | 580767 | 581009 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 8 | 51688 | 51930 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 9 | 1239047 | 1239289 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 10 | 324790 | 325032 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 11 | 567676 | 567915 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 12 | 269325 | 269570 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 13 | 282150 | 282395 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 14 | 334418 | 334660 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 15 | 1714464 | 1714706 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 16 | 1110815 | 1111057 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 17 | 86030 | 86272 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 18 | 1471108 | 1471347 | - | NZ_LS483343.1 | Streptococcus ferus |
| 19 | 1075362 | 1075598 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 20 | 1114966 | 1115202 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 21 | 1615659 | 1615895 | - | NC_012924.1 | Streptococcus suis SC84 |
| 22 | 1448787 | 1448984 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 23 | 229080 | 229316 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 24 | 900650 | 900886 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 25 | 1584211 | 1584447 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 26 | 1386781 | 1386978 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 27 | 1726136 | 1726363 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 28 | 1612673 | 1612888 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 29 | 952558 | 952773 | - | NZ_CP029476.1 | Lactobacillus apis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483403.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 0.76 | 22 | 2887.0 | same-strand | Phage integrase family |
| 2 | PF00571.30 | 0.93 | 27 | 2454 | same-strand | CBS domain |
| 3 | PF12850.9 | 0.97 | 28 | 1935.0 | same-strand | Calcineurin-like phosphoesterase superfamily domain |
| 4 | PF01725.18 | 0.97 | 28 | 971.0 | same-strand | Ham1 family |
| 5 | PF01177.24 | 0.97 | 28 | 179.0 | same-strand | Asp/Glu/Hydantoin racemase |
| 6 | PF01027.22 | 0.62 | 18 | 1464.5 | same-strand | Inhibitor of apoptosis-promoting Bax1 |
| 7 | PF02784.18 | 0.72 | 21 | 117 | same-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
| 8 | PF00278.24 | 0.72 | 21 | 117 | same-strand | Pyridoxal-dependent decarboxylase, C-terminal sheet domain |
++ More..