Result : Q8DRX9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein SMU_2077c |
| NCBI Accession ID | AE014133.2 |
| Organism | Streptococcus mutans serotype c (strain ATCC 700610 / UA159) |
| Left | 1952844 |
| Right | 1953143 |
| Strand | - |
| Nucleotide Sequence | ATGTCACATAATCATGAACAAGAGCATGATCTTATCACGCTTGTTGATGAACAAGGAAATGAAACTTTGTTCGAAGTTCTTTTGACTATTGATGGTAAAGAGGAATTTGGAAAAAATTATGTTCTCTTGGTTCCAGCGGGTGCTGAAGAAGATGCTGATGGTCAAATTGAAATTCAGGCCTATTCATTTACTGAAAATGAAGATGGAACAGAAGGGGCTCTTCAACCTATTCCAGAAGATGCTGATGCTGAATGGATTATGATCGAAGAAGTCTTTAATAGTTTTTTAGATGAAGATTGA |
| Sequence | MSHNHEQEHDLITLVDEQGNETLFEVLLTIDGKEEFGKNYVLLVPAGAEEDADGQIEIQAYSFTENEDGTEGALQPIPEDADAEWIMIEEVFNSFLDED |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | 12397186 |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | Q8DRX9 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 115
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1670753 | 1671052 | + | NZ_CP013237.1 | Streptococcus mutans |
| 2 | 2017286 | 2017585 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 3 | 491059 | 491364 | - | NZ_CP043405.1 | Streptococcus ratti |
| 4 | 1301524 | 1301823 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 5 | 1801678 | 1801977 | - | NZ_LS483343.1 | Streptococcus ferus |
| 6 | 1697361 | 1697618 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 7 | 1947417 | 1947716 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 8 | 1704809 | 1705114 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 9 | 2067883 | 2068182 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 10 | 2353075 | 2353374 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 11 | 2032476 | 2032784 | + | NZ_LT906439.1 | Streptococcus merionis |
| 12 | 26561 | 26818 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 13 | 1534651 | 1534956 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 14 | 1879286 | 1879591 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 15 | 1870877 | 1871182 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 16 | 1804246 | 1804551 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 17 | 734920 | 735237 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 18 | 2056620 | 2056925 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 19 | 280270 | 280575 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 20 | 673680 | 673985 | + | NZ_LR134293.1 | Streptococcus canis |
| 21 | 2092948 | 2093205 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 22 | 1955839 | 1956144 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 23 | 1884811 | 1885116 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 24 | 1885664 | 1885975 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 25 | 1768495 | 1768800 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 26 | 649301 | 649555 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 27 | 1783908 | 1784174 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 28 | 1826567 | 1826833 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 29 | 1943774 | 1944091 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 30 | 280680 | 280997 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 31 | 2105874 | 2106140 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 32 | 720856 | 721113 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 33 | 70321 | 70581 | + | NC_012924.1 | Streptococcus suis SC84 |
| 34 | 70895 | 71149 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 35 | 2012839 | 2013108 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 36 | 681214 | 681468 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 37 | 101551 | 101868 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 38 | 1328913 | 1329176 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 39 | 1854272 | 1854595 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 40 | 235026 | 235349 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 41 | 2266211 | 2266534 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 42 | 322729 | 322995 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 43 | 121114 | 121437 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 44 | 2164197 | 2164451 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 45 | 552936 | 553247 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 46 | 1941207 | 1941518 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 47 | 693706 | 693954 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 48 | 771352 | 771600 | + | NZ_CP065211.1 | Enterococcus lactis |
| 49 | 746218 | 746469 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 50 | 1354618 | 1354929 | + | NZ_CP023011.2 | Enterococcus hirae |
| 51 | 89348 | 89659 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 52 | 1526508 | 1526819 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 53 | 1116797 | 1117111 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 54 | 2649466 | 2649783 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 55 | 125540 | 125845 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 56 | 1094440 | 1094739 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 57 | 1194385 | 1194720 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 58 | 3311646 | 3311939 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 59 | 106456 | 106707 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 60 | 499833 | 500147 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 61 | 1265879 | 1266196 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 62 | 2397988 | 2398308 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 63 | 1477430 | 1477672 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 64 | 1953577 | 1953885 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 65 | 1567108 | 1567395 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 66 | 1847017 | 1847328 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 67 | 818775 | 819029 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 68 | 736406 | 736648 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 69 | 1487397 | 1487708 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 70 | 1887584 | 1887901 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 71 | 3459469 | 3459756 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 72 | 1637176 | 1637466 | + | NZ_LS483476.1 | Lederbergia lentus |
| 73 | 2722683 | 2723009 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 74 | 1321966 | 1322265 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 75 | 3418854 | 3419135 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 76 | 506694 | 506978 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 77 | 3177972 | 3178262 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 78 | 1317158 | 1317442 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 79 | 2680725 | 2681006 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 80 | 1353865 | 1354146 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 81 | 1246542 | 1246829 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 82 | 2607671 | 2607952 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 83 | 495318 | 495635 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 84 | 706468 | 706788 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 85 | 1457953 | 1458282 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 86 | 597374 | 597694 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 87 | 1427628 | 1427924 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 88 | 744914 | 745177 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 89 | 2797100 | 2797381 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 90 | 2615390 | 2615671 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 91 | 1393356 | 1393667 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 92 | 1415252 | 1415560 | + | NZ_CP016540.2 | Planococcus versutus |
| 93 | 2533361 | 2533642 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 94 | 3500247 | 3500528 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 95 | 570715 | 571008 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 96 | 1211586 | 1211882 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 97 | 1693699 | 1693995 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 98 | 1448149 | 1448460 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 99 | 1442121 | 1442363 | + | NZ_CP016538.2 | Planococcus maritimus |
| 100 | 1451528 | 1451770 | + | NZ_CP059540.1 | Planococcus maritimus |
| 101 | 1194949 | 1195191 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 102 | 1422929 | 1423243 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 103 | 2629808 | 2630089 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 104 | 2192886 | 2193173 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 105 | 2569780 | 2570085 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 106 | 1477883 | 1478125 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 107 | 1349193 | 1349465 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 108 | 1566790 | 1567032 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 109 | 2018625 | 2018918 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 110 | 2755135 | 2755419 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 111 | 294182 | 294424 | - | NZ_CP013661.2 | Planococcus kocurii |
| 112 | 1488682 | 1488924 | + | NZ_CP019401.1 | Planococcus faecalis |
| 113 | 3416161 | 3416448 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 114 | 2322315 | 2322560 | - | NZ_CP012024.1 | Bacillus smithii |
| 115 | 1336226 | 1336534 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 116 | 2576275 | 2576529 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013237.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06135.14 | 1.0 | 115 | 454 | same-strand | IreB regulatory phosphoprotein |
| 2 | PF03652.17 | 1.0 | 115 | 28.0 | same-strand | Holliday junction resolvase |
++ More..