Result : Q8DKQ5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0367 protein tsr0804 |
| NCBI Accession ID | BA000039.2 |
| Organism | Thermosynechococcus elongatus (strain BP-1) |
| Left | 832416 |
| Right | 832697 |
| Strand | + |
| Nucleotide Sequence | ATGTACACGATTGATTTAATTCTGCGTCATGTCCCCATGCCCGTCAGCATTGAACGCAAGGAAAGTGCAGCAGCGATGGCAGTCTATCAGCAAATTCAGCAGGCCATGGCCAGTGGTACTCCAACTTTCCTCGAACTGACGTGCGATCGCCAAGTGGGCAAGAAGTTAACGGTGCTCACCTCAGAAATTGTCGCCGTGCAAATGGCGGATAAGGATGCCCCCTCCAGTACTATCAGTCGTGGGGGATTCTTTGCTCAATTAGTGCAGCAAACCAGCAACTGA |
| Sequence | MYTIDLILRHVPMPVSIERKESAAAMAVYQQIQQAMASGTPTFLELTCDRQVGKKLTVLTSEIVAVQMADKDAPSSTISRGGFFAQLVQQTSN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of PRK13683. Profile Description: hypothetical protein; Provisional |
| Pubmed ID | 12240834 |
| Domain | CDD:184240 |
| Functional Category | Others |
| Uniprot ID | Q8DKQ5 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 226809 | 227090 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 2 | 832416 | 832697 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 3 | 2085040 | 2085321 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 1878213 | 1878479 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 5 | 1871264 | 1871533 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01553.23 | 0.6 | 3 | 886 | same-strand | Acyltransferase |
| 2 | PF10989.10 | 0.6 | 3 | 151 | same-strand | Protein of unknown function (DUF2808) |
| 3 | PF13419.8 | 0.6 | 3 | 63 | same-strand | Haloacid dehalogenase-like hydrolase |
| 4 | PF00702.28 | 0.6 | 3 | 63 | same-strand | haloacid dehalogenase-like hydrolase |
| 5 | PF00271.33 | 0.6 | 3 | 1717 | same-strand | Helicase conserved C-terminal domain |
| 6 | PF00270.31 | 0.6 | 3 | 1717 | same-strand | DEAD/DEAH box helicase |
++ More..