Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0367 protein tsr0804 |
NCBI Accession ID | BA000039.2 |
Organism | Thermosynechococcus elongatus (strain BP-1) |
Left | 832416 |
Right | 832697 |
Strand | + |
Nucleotide Sequence | ATGTACACGATTGATTTAATTCTGCGTCATGTCCCCATGCCCGTCAGCATTGAACGCAAGGAAAGTGCAGCAGCGATGGCAGTCTATCAGCAAATTCAGCAGGCCATGGCCAGTGGTACTCCAACTTTCCTCGAACTGACGTGCGATCGCCAAGTGGGCAAGAAGTTAACGGTGCTCACCTCAGAAATTGTCGCCGTGCAAATGGCGGATAAGGATGCCCCCTCCAGTACTATCAGTCGTGGGGGATTCTTTGCTCAATTAGTGCAGCAAACCAGCAACTGA |
Sequence | MYTIDLILRHVPMPVSIERKESAAAMAVYQQIQQAMASGTPTFLELTCDRQVGKKLTVLTSEIVAVQMADKDAPSSTISRGGFFAQLVQQTSN |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of PRK13683. Profile Description: hypothetical protein; Provisional |
Pubmed ID | 12240834 |
Domain | CDD:184240 |
Functional Category | Others |
Uniprot ID | Q8DKQ5 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 226809 | 227090 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
2 | 832416 | 832697 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
3 | 2085040 | 2085321 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
4 | 1878213 | 1878479 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
5 | 1871264 | 1871533 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01553.23 | 0.6 | 3 | 886 | same-strand | Acyltransferase |
2 | PF10989.10 | 0.6 | 3 | 151 | same-strand | Protein of unknown function (DUF2808) |
3 | PF13419.8 | 0.6 | 3 | 63 | same-strand | Haloacid dehalogenase-like hydrolase |
4 | PF00702.28 | 0.6 | 3 | 63 | same-strand | haloacid dehalogenase-like hydrolase |
5 | PF00271.33 | 0.6 | 3 | 1717 | same-strand | Helicase conserved C-terminal domain |
6 | PF00270.31 | 0.6 | 3 | 1717 | same-strand | DEAD/DEAH box helicase |