Result : Q8DKM3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II protein Y |
| NCBI Accession ID | |
| Organism | Thermosynechococcus elongatus (strain BP-1) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MDWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLLQKAKAA |
| Source of smORF | Swiss-Prot |
| Function | Loosely associated component of the core of photosystem II, it is not always seen in crystals. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation. {ECO:0000255|HAMAP-Rule:MF_00717, ECO:0000269|Pubmed:19219048, ECO:0000269|Pubmed:20558739, ECO:0000303|Pubmed:19219048}. |
| Pubmed ID | 12240834 17935689 19219048 20558739 |
| Domain | CDD:399361 |
| Functional Category | Others |
| Uniprot ID | Q8DKM3 |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 859712 | 859837 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 2 | 1099097 | 1099222 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 3 | 389275 | 389388 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 4 | 701309 | 701434 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 5 | 2741148 | 2741267 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 6 | 2610605 | 2610730 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 7 | 950932 | 951054 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 8 | 3144518 | 3144640 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 9 | 2995960 | 2996085 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 10 | 4688354 | 4688473 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 11 | 3697996 | 3698106 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 12 | 2940696 | 2940818 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 13 | 2357303 | 2357422 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 14 | 1337637 | 1337762 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 15 | 5045337 | 5045462 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 16 | 328800 | 328925 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 17 | 893688 | 893810 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 18 | 1271877 | 1271996 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 19 | 3826935 | 3827045 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014638.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00132.26 | 0.63 | 12 | 92.5 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 2 | PF14602.8 | 0.63 | 12 | 92.5 | same-strand | Hexapeptide repeat of succinyl-transferase |
++ More..