Result : Q8DKB4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Carboxysome shell vertex protein CcmL (Carbon dioxide concentrating mechanism protein CcmL) |
| NCBI Accession ID | BA000039.2 |
| Organism | Thermosynechococcus elongatus (strain BP-1) |
| Left | 966722 |
| Right | 967021 |
| Strand | - |
| Nucleotide Sequence | GTGAAAATCGCGCGAGTGTGCGGCACCGTTACCAGTACTCAAAAAGAAGACACCTTAACGGGAGTCAAGTTTCTCGTCTTGCAATATTTGGGTGAGGACGGCGAATTTTTACCCGACTACGAAGTGGCTGCGGATACGGTTGGTGCAGGACAGGATGAGTGGGTATTGGTAAGCCGAGGCAGTGCCGCCCGCCATATTATCAATGGCACCGACAAACCCATTGACGCAGCCGTTGTCGCCATTATTGACACCGTAAGTCGGGATAATTATTTGCTCTACAGCAAACGTACCCAGTATTAG |
| Sequence | MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGEDGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYSKRTQY |
| Source of smORF | Swiss-Prot |
| Function | Probably forms vertices in the carboxysome, a polyhedral inclusion where RuBisCO (ribulose bisphosphate carboxylase, rbcL-rbcS) is sequestered. Has been modeled to induce curvature upon insertion into an otherwise flat hexagonal molecular layer of CcmK subunits. {ECO:0000250|UniProtKB:P72759, ECO:0000255|HAMAP-Rule:MF_00858}. |
| Pubmed ID | 12240834 23949415 24504539 |
| Domain | CDD:413110 |
| Functional Category | Others |
| Uniprot ID | Q8DKB4 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 989360 | 989659 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 2 | 966722 | 967021 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 3 | 845730 | 846029 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 710690 | 710992 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 5 | 1795359 | 1795661 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 6 | 1257118 | 1257417 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 7 | 3919002 | 3919304 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 8 | 4309367 | 4309669 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 9 | 5379766 | 5380068 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 10 | 2248293 | 2248595 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 11 | 3397322 | 3397624 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 12 | 3220100 | 3220408 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 13 | 1130101 | 1130415 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 14 | 772671 | 772973 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 15 | 592717 | 593016 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 16 | 353588 | 353911 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 17 | 6183559 | 6183864 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 18 | 531973 | 532278 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 19 | 814827 | 815129 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 20 | 374042 | 374350 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 21 | 1752010 | 1752312 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 22 | 1002980 | 1003288 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 23 | 1508270 | 1508581 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 24 | 2442067 | 2442375 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 25 | 4395218 | 4395529 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 26 | 1795086 | 1795376 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 27 | 1935080 | 1935385 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 28 | 1467754 | 1468050 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 29 | 5442344 | 5442631 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 30 | 2625710 | 2625985 | + | NZ_LR134340.1 | Escherichia marmotae |
| 31 | 2049960 | 2050235 | + | NZ_AP014857.1 | Escherichia albertii |
| 32 | 2372321 | 2372596 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 33 | 1023518 | 1023793 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 34 | 476409 | 476684 | - | NZ_CP038469.1 | Citrobacter tructae |
| 35 | 4318846 | 4319121 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 36 | 781826 | 782101 | + | NZ_CP033744.1 | Citrobacter freundii |
| 37 | 4330843 | 4331118 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 38 | 2513938 | 2514213 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 39 | 1040230 | 1040505 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 40 | 1134138 | 1134413 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 41 | 2846559 | 2846834 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 42 | 2124926 | 2125201 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 43 | 2278741 | 2279007 | - | NZ_LS483250.1 | Moritella yayanosii |
| 44 | 116234 | 116521 | - | NZ_CP061725.1 | Micromonospora craniellae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00936.21 | 1.0 | 44 | 838 | same-strand | BMC domain |
| 2 | PF00101.22 | 0.66 | 29 | 107 | same-strand | Ribulose bisphosphate carboxylase, small chain |
++ More..