Result : A9ESS9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | AM746676.1 |
| Organism | Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56)) |
| Left | 10114624 |
| Right | 10114821 |
| Strand | - |
| Nucleotide Sequence | ATGCCGAAGATGAAGACCAACCGCGCCGCGGCCAAGCGCTTCAAGGTGACCGGCTCCGGCCGCATTCGCCGCAGCAAGGGCGGGCTCAACCACTGCATGCAGGAGAAGAGCAAGAAGCGGCTGCGTCGTCTCCGCAAGAACGACATGGTCGATTCGGCGATGGAGAAGCGCGTCAAGCTGCTTCTTCCCTACGGCTGA |
| Sequence | MPKMKTNRAAAKRFKVTGSGRIRRSKGGLNHCMQEKSKKRLRRLRKNDMVDSAMEKRVKLLLPYG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17965706 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A9ESS9 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 350
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 10114624 | 10114821 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 2 | 10160203 | 10160400 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 3 | 9464718 | 9464915 | + | NZ_CP016211.1 | Minicystis rosea |
| 4 | 1591668 | 1591865 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 5 | 937213 | 937410 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 6 | 5314040 | 5314243 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 7 | 1738299 | 1738499 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 8 | 1883562 | 1883759 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 9 | 59859 | 60056 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 10 | 542751 | 542948 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 11 | 2831063 | 2831260 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 12 | 1073775 | 1073972 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 13 | 570973 | 571170 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 14 | 3718865 | 3719062 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 15 | 1615160 | 1615357 | + | NZ_CP040924.1 | Clostridium thermarum |
| 16 | 871979 | 872176 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 17 | 1624426 | 1624623 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 18 | 2927688 | 2927885 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 19 | 3049653 | 3049850 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 20 | 1649362 | 1649559 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 21 | 964851 | 965045 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 22 | 2388455 | 2388652 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 23 | 655541 | 655738 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 24 | 2345227 | 2345424 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 25 | 3168790 | 3168987 | + | NZ_CP023671.1 | Clostridium septicum |
| 26 | 964794 | 964991 | + | NC_008593.1 | Clostridium novyi NT |
| 27 | 3567042 | 3567239 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 28 | 2098968 | 2099162 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 29 | 1282322 | 1282519 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 30 | 1668787 | 1668984 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 31 | 2470351 | 2470548 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 32 | 3308058 | 3308255 | - | NZ_CP028842.1 | Clostridium botulinum |
| 33 | 3551061 | 3551258 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 34 | 1525880 | 1526077 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 35 | 297056 | 297256 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 36 | 868506 | 868703 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 37 | 1791633 | 1791830 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 38 | 2398498 | 2398695 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 39 | 798694 | 798891 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 40 | 6175981 | 6176178 | - | NZ_CP061799.1 | Desulfonema limicola |
| 41 | 1174259 | 1174456 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 42 | 775796 | 775993 | - | NZ_CP070062.1 | Coprococcus comes |
| 43 | 3190382 | 3190585 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 44 | 1617613 | 1617810 | - | NZ_CP029256.1 | Christensenella minuta |
| 45 | 74509 | 74703 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 46 | 800578 | 800775 | + | NZ_CP016786.1 | Clostridium isatidis |
| 47 | 1437079 | 1437276 | - | NZ_CP016786.1 | Clostridium isatidis |
| 48 | 728029 | 728226 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 49 | 859193 | 859390 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 50 | 1492497 | 1492694 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 51 | 559531 | 559728 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 52 | 1467285 | 1467482 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 53 | 1782707 | 1782907 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 54 | 1641151 | 1641348 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 55 | 3924771 | 3924968 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 56 | 2321628 | 2321825 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 57 | 916097 | 916294 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 58 | 4748937 | 4749134 | - | NZ_CP020953.1 | Clostridium drakei |
| 59 | 5157317 | 5157514 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 60 | 2354826 | 2355023 | - | NZ_CP036259.1 | Sporomusa termitida |
| 61 | 2573233 | 2573442 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 62 | 3604213 | 3604410 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 63 | 456857 | 457054 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 64 | 1766793 | 1766990 | - | NZ_LR699011.1 | Roseburia hominis |
| 65 | 1610228 | 1610425 | + | NZ_CP014176.1 | Clostridium argentinense |
| 66 | 922479 | 922676 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 67 | 810119 | 810316 | + | NZ_CP030280.1 | Blautia argi |
| 68 | 1631211 | 1631408 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 69 | 250290 | 250487 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 70 | 2311684 | 2311881 | - | NZ_HG917868.1 | Clostridium bornimense |
| 71 | 1552719 | 1552916 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 72 | 3211173 | 3211370 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 73 | 1488982 | 1489179 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 74 | 2238640 | 2238837 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 75 | 4311968 | 4312165 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 76 | 1440403 | 1440600 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 77 | 3767216 | 3767413 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 78 | 2385893 | 2386090 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 79 | 3793895 | 3794092 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 80 | 70204 | 70395 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 81 | 1921318 | 1921515 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 82 | 2278397 | 2278594 | - | NZ_LN879430.1 | Herbinix luporum |
| 83 | 1773115 | 1773312 | - | NZ_CP014204.2 | Clostridium baratii |
| 84 | 763520 | 763717 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 85 | 1688880 | 1689077 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 86 | 459111 | 459308 | - | NC_012780.1 | [Eubacterium] eligens ATCC 27750 |
| 87 | 2922538 | 2922738 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 88 | 4792675 | 4792872 | - | NZ_CP039126.1 | Blautia producta |
| 89 | 644290 | 644487 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 90 | 2380823 | 2381017 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 91 | 1369950 | 1370147 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 92 | 756379 | 756576 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 93 | 763631 | 763828 | + | NZ_LR134375.1 | Veillonella dispar |
| 94 | 864183 | 864380 | + | NZ_LR778174.1 | Veillonella parvula |
| 95 | 1306011 | 1306208 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 96 | 427739 | 427939 | + | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 97 | 640598 | 640795 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 98 | 857823 | 858020 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 99 | 2468582 | 2468779 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 100 | 13951 | 14148 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 101 | 2509242 | 2509439 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 102 | 1119185 | 1119382 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 103 | 2651861 | 2652058 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 104 | 2062446 | 2062643 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 105 | 1477506 | 1477703 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 106 | 1012618 | 1012815 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 107 | 4380666 | 4380863 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 108 | 516861 | 517058 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 109 | 419701 | 419898 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
| 110 | 2182436 | 2182630 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 111 | 1352254 | 1352451 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 112 | 1335046 | 1335243 | - | NZ_LT906470.1 | Veillonella rodentium |
| 113 | 2011687 | 2011884 | - | NZ_CP012154.1 | Wenzhouxiangella marina |
| 114 | 1170934 | 1171131 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 115 | 537142 | 537339 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 116 | 870465 | 870662 | + | NZ_CP044060.1 | Aeromonas veronii |
| 117 | 1068971 | 1069168 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 118 | 1256613 | 1256807 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 119 | 457804 | 458001 | - | NZ_LT996885.1 | Dialister massiliensis |
| 120 | 555619 | 555816 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 121 | 3016550 | 3016747 | - | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 122 | 1560141 | 1560338 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 123 | 1153441 | 1153638 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 124 | 1727441 | 1727641 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 125 | 1649982 | 1650173 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 126 | 3253410 | 3253610 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 127 | 2124806 | 2125009 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 128 | 4167509 | 4167706 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 129 | 2771441 | 2771641 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 130 | 1580280 | 1580477 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 131 | 810951 | 811148 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 132 | 1654253 | 1654450 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 133 | 6117417 | 6117614 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 134 | 2302330 | 2302527 | - | NZ_CP035108.1 | Geovibrio thiophilus |
| 135 | 1483435 | 1483635 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 136 | 3443121 | 3443318 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 137 | 1385487 | 1385684 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 138 | 1138744 | 1138944 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 139 | 825181 | 825378 | + | NZ_CP034118.1 | Staphylospora marina |
| 140 | 2831948 | 2832148 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 141 | 1190209 | 1190409 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 142 | 3065807 | 3066004 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 143 | 654141 | 654338 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 144 | 1549936 | 1550133 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 145 | 1241901 | 1242098 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 146 | 1522152 | 1522349 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 147 | 1296864 | 1297061 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 148 | 2330922 | 2331119 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 149 | 2408632 | 2408826 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 150 | 115547 | 115744 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 151 | 1163471 | 1163671 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 152 | 1666060 | 1666257 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 153 | 6520164 | 6520361 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 154 | 1272365 | 1272559 | - | NC_002971.4 | Coxiella burnetii RSA 493 |
| 155 | 381375 | 381569 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 156 | 1413899 | 1414099 | + | NZ_CP072793.1 | Thiothrix unzii |
| 157 | 4260283 | 4260480 | - | NZ_CP026363.1 | Brevibacillus agri |
| 158 | 1435461 | 1435658 | + | NZ_CP040449.1 | Aeromonas simiae |
| 159 | 2871094 | 2871291 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 160 | 1286260 | 1286460 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 161 | 1269668 | 1269868 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 162 | 1522857 | 1523054 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 163 | 1083174 | 1083371 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 164 | 993103 | 993303 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 165 | 3167593 | 3167787 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 166 | 4509298 | 4509495 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 167 | 132781 | 132981 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 168 | 1353798 | 1353995 | + | NZ_CP030775.1 | Clostridium butyricum |
| 169 | 1517243 | 1517440 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 170 | 1535537 | 1535734 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 171 | 2823932 | 2824126 | + | NZ_CP035494.1 | Microbacterium protaetiae |
| 172 | 2118852 | 2119052 | - | NZ_CP027770.1 | Staphylococcus felis |
| 173 | 140219 | 140416 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 174 | 2473329 | 2473529 | - | NZ_CP012024.1 | Bacillus smithii |
| 175 | 966638 | 966826 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 176 | 1201839 | 1202039 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 177 | 959739 | 959939 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 178 | 526308 | 526505 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 179 | 450741 | 450929 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 180 | 1319509 | 1319709 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 181 | 1377270 | 1377467 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 182 | 3629665 | 3629865 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 183 | 3138667 | 3138867 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 184 | 3764010 | 3764210 | - | NZ_CP053989.1 | Niallia circulans |
| 185 | 1441163 | 1441357 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 186 | 1643463 | 1643651 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 187 | 1041748 | 1041948 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 188 | 1240627 | 1240827 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 189 | 1550041 | 1550241 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 190 | 387970 | 388170 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 191 | 2757799 | 2757999 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 192 | 2765564 | 2765764 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 193 | 2831392 | 2831592 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 194 | 3342077 | 3342277 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 195 | 2952615 | 2952815 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 196 | 3431004 | 3431204 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 197 | 1310439 | 1310639 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 198 | 1352742 | 1352942 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 199 | 1741538 | 1741738 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 200 | 1895967 | 1896161 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 201 | 1159679 | 1159879 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 202 | 269302 | 269502 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 203 | 1633065 | 1633262 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 204 | 287271 | 287468 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 205 | 547735 | 547923 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 206 | 1908571 | 1908771 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 207 | 2139743 | 2139943 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 208 | 274588 | 274794 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 209 | 298542 | 298748 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 210 | 1209717 | 1209917 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 211 | 999065 | 999265 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 212 | 1195939 | 1196139 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 213 | 1253171 | 1253371 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 214 | 609575 | 609775 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 215 | 4393319 | 4393522 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 216 | 1796855 | 1797052 | + | NZ_CP043998.1 | Clostridium diolis |
| 217 | 1049524 | 1049724 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 218 | 1445060 | 1445260 | + | NZ_LS483476.1 | Lederbergia lentus |
| 219 | 1672675 | 1672875 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 220 | 1327191 | 1327388 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 221 | 1057620 | 1057820 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 222 | 2837177 | 2837377 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 223 | 2769604 | 2769804 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 224 | 2919328 | 2919528 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 225 | 3105155 | 3105355 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 226 | 545290 | 545487 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 227 | 742151 | 742348 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 228 | 1747327 | 1747527 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 229 | 1682852 | 1683052 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 230 | 817275 | 817475 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 231 | 130167 | 130367 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 232 | 1145058 | 1145246 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 233 | 1196275 | 1196475 | + | NZ_CP011937.1 | Bacillus velezensis |
| 234 | 2791407 | 2791607 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 235 | 3294771 | 3294971 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 236 | 1506054 | 1506251 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
| 237 | 371264 | 371458 | - | NC_012115.1 | Nautilia profundicola AmH |
| 238 | 2819366 | 2819566 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 239 | 2730616 | 2730816 | + | NZ_CP043404.1 | Bacillus safensis |
| 240 | 4508023 | 4508223 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 241 | 2327876 | 2328076 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 242 | 2334840 | 2335040 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 243 | 2573105 | 2573305 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 244 | 4593435 | 4593632 | - | NZ_CP007451.1 | Draconibacterium orientale |
| 245 | 476234 | 476431 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 246 | 1620260 | 1620457 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 247 | 1751115 | 1751312 | - | NZ_CP014322.1 | Alteromonas addita |
| 248 | 2393658 | 2393855 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 249 | 639377 | 639577 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 250 | 1378986 | 1379186 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 251 | 1759472 | 1759669 | + | NZ_CP008849.1 | Alteromonas australica |
| 252 | 4067654 | 4067848 | + | NZ_CP060713.1 | Nocardioides mesophilus |
| 253 | 3993341 | 3993544 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 254 | 3649195 | 3649392 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 255 | 706893 | 707075 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 256 | 1891385 | 1891582 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 257 | 710473 | 710673 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 258 | 1400243 | 1400443 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 259 | 1062679 | 1062879 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 260 | 1480201 | 1480398 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 261 | 1722512 | 1722703 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 262 | 1330079 | 1330279 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 263 | 2657873 | 2658067 | - | NZ_CP027433.1 | Gordonia iterans |
| 264 | 1489032 | 1489232 | + | NZ_CP043405.1 | Streptococcus ratti |
| 265 | 1440749 | 1440949 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 266 | 731689 | 731886 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 267 | 1038354 | 1038554 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 268 | 1323506 | 1323703 | - | NC_023035.1 | Salinispira pacifica |
| 269 | 1075390 | 1075590 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 270 | 1316182 | 1316382 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 271 | 2220081 | 2220281 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 272 | 2002525 | 2002722 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 273 | 544465 | 544665 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 274 | 1109905 | 1110105 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 275 | 1640938 | 1641138 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 276 | 1568639 | 1568839 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 277 | 1507979 | 1508179 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 278 | 1213840 | 1214037 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 279 | 830255 | 830455 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 280 | 739924 | 740124 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 281 | 1123502 | 1123702 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 282 | 2055808 | 2056008 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 283 | 612959 | 613159 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 284 | 956138 | 956338 | - | NZ_CP013237.1 | Streptococcus mutans |
| 285 | 1053810 | 1054010 | - | NZ_CP029476.1 | Lactobacillus apis |
| 286 | 1196589 | 1196789 | - | NZ_LS483343.1 | Streptococcus ferus |
| 287 | 1090568 | 1090768 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 288 | 1562665 | 1562865 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 289 | 597797 | 597991 | - | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 290 | 582726 | 582926 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 291 | 891543 | 891743 | - | NZ_LT906439.1 | Streptococcus merionis |
| 292 | 1676834 | 1677037 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 293 | 761629 | 761829 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 294 | 1133790 | 1133990 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 295 | 1028144 | 1028338 | - | NZ_CP012333.1 | Labilithrix luteola |
| 296 | 1272112 | 1272312 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 297 | 1211962 | 1212162 | - | NC_012924.1 | Streptococcus suis SC84 |
| 298 | 868478 | 868675 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 299 | 1206260 | 1206460 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 300 | 1292790 | 1292990 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 301 | 525772 | 525969 | + | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 302 | 109651 | 109851 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 303 | 1387935 | 1388135 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 304 | 1064635 | 1064832 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 305 | 449610 | 449807 | + | NZ_CP042433.1 | Flavisolibacter ginsenosidimutans |
| 306 | 1142612 | 1142809 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 307 | 2562389 | 2562586 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 308 | 1154008 | 1154208 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 309 | 3224245 | 3224442 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 310 | 1378138 | 1378338 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 311 | 715101 | 715301 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 312 | 2344947 | 2345144 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 313 | 1188308 | 1188505 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 314 | 2480305 | 2480502 | - | NZ_AP022188.1 | Aeromonas media |
| 315 | 1534682 | 1534876 | - | NZ_CP009251.1 | Corynebacterium stationis |
| 316 | 1287943 | 1288143 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 317 | 3776360 | 3776557 | + | NZ_CP029186.1 | Flavobacterium album |
| 318 | 1915584 | 1915781 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 319 | 4814991 | 4815188 | + | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
| 320 | 663992 | 664195 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 321 | 1233780 | 1233977 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 322 | 1248407 | 1248604 | + | NZ_CP048113.1 | Chitinophaga agri |
| 323 | 1526215 | 1526412 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 324 | 2196705 | 2196899 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 325 | 1461076 | 1461270 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 326 | 4723932 | 4724129 | - | NC_013132.1 | Chitinophaga pinensis DSM 2588 |
| 327 | 497198 | 497392 | + | NC_008789.1 | Halorhodospira halophila SL1 |
| 328 | 1799580 | 1799777 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 329 | 1821708 | 1821911 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 330 | 1342704 | 1342904 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 331 | 6549579 | 6549776 | - | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 332 | 3200311 | 3200505 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 333 | 2116044 | 2116241 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 334 | 1681550 | 1681744 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 335 | 1923989 | 1924186 | - | NZ_CP009302.1 | Berryella intestinalis |
| 336 | 893027 | 893224 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 337 | 4721583 | 4721786 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 338 | 45773 | 45967 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 339 | 2069301 | 2069495 | - | NC_014624.2 | Eubacterium callanderi |
| 340 | 706220 | 706414 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 341 | 3805964 | 3806158 | - | NZ_CP019962.1 | Eubacterium limosum |
| 342 | 1006041 | 1006238 | - | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 343 | 38669 | 38866 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 344 | 1460620 | 1460811 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 345 | 4107932 | 4108126 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 346 | 2978930 | 2979127 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 347 | 1871810 | 1872007 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 348 | 1675562 | 1675759 | + | NZ_CP017477.1 | Polaribacter vadi |
| 349 | 111112 | 111309 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 350 | 1611338 | 1611529 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 351 | 2090569 | 2090766 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 352 | 2472260 | 2472457 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014365.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 0.99 | 347 | 37 | same-strand | Ribosomal protein L20 |
| 2 | PF00707.24 | 0.91 | 319 | 28.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 3 | PF05198.18 | 0.76 | 265 | 28.0 | same-strand | Translation initiation factor IF-3, N-terminal domain |
++ More..