Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II reaction center protein Ycf12 |
NCBI Accession ID | BA000039.2 |
Organism | Thermosynechococcus elongatus (strain BP-1) |
Left | 1287879 |
Right | 1288019 |
Strand | + |
Nucleotide Sequence | ATGGGAATTTTCAATGGCATTATTGAGTTTCTTAGCAATATCAACTTTGAAGTCATTGCCCAACTGACCATGATTGCCATGATTGGCATTGCAGGGCCGATGATTATTTTCCTGTTGGCAGTGCGTCGCGGCAATTTGTAG |
Sequence | MGIFNGIIEFLSNINFEVIAQLTMIAMIGIAGPMIIFLLAVRRGNL |
Source of smORF | Swiss-Prot |
Function | A core subunit of photosystem II (PSII). PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation. {ECO:0000269|Pubmed:20558739, ECO:0000269|Pubmed:21367867, ECO:0000269|Pubmed:25006873}. |
Pubmed ID | 12240834 17935689 17967798 19219048 20558739 21367867 22665786 23413188 25043005 25006873 |
Domain | CDD:421560 |
Functional Category | Others |
Uniprot ID | Q8DJI1 |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1287879 | 1288019 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
2 | 1408015 | 1408155 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
3 | 2385432 | 2385572 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
4 | 660761 | 660892 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
5 | 2709991 | 2710122 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
6 | 114428 | 114556 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
7 | 369010 | 369141 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
8 | 3270097 | 3270216 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
9 | 1815154 | 1815273 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
10 | 4229766 | 4229888 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
11 | 5751807 | 5751926 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
12 | 2808570 | 2808689 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
13 | 2960802 | 2960933 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
14 | 5892369 | 5892491 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
15 | 2706868 | 2706999 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
16 | 6078006 | 6078128 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
17 | 218089 | 218208 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
18 | 1149506 | 1149637 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
19 | 3444571 | 3444687 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03692.17 | 0.68 | 13 | 146 | opposite-strand | Putative zinc- or iron-chelating domain |