Result : Q8DJ15
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex subunit PetM) (Cytochrome b6-f complex subunit VII) |
| NCBI Accession ID | BA000039.2 |
| Organism | Thermosynechococcus elongatus (strain BP-1) |
| Left | 1482638 |
| Right | 1482739 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGAAGAGATTTTCAACACTGCGGTAATTACCTTTACACTGGTTCTGGTGGGTTTAGGTGCAGGCTACCTGCTGTTGCGCTTGACCCCAGACGATTAA |
| Sequence | MAEEIFNTAVITFTLVLVGLGAGYLLLRLTPDD |
| Source of smORF | Swiss-Prot |
| Function | Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. {ECO:0000255|HAMAP-Rule:MF_00396}. |
| Pubmed ID | 12240834 |
| Domain | CDD:183354 |
| Functional Category | Others |
| Uniprot ID | Q8DJ15 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1482638 | 1482739 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 2 | 1141269 | 1141370 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 3 | 2354709 | 2354810 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 2670709 | 2670807 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 5 | 444789 | 444893 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 6 | 1700790 | 1700900 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 7 | 1564222 | 1564335 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 8 | 349289 | 349393 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 9 | 5991156 | 5991263 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
++ More..