Result : Q8DIP0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome b559 subunit alpha (PSII reaction center subunit V) |
| NCBI Accession ID | BA000039.2 |
| Organism | Thermosynechococcus elongatus (strain BP-1) |
| Left | 1610317 |
| Right | 1610571 |
| Strand | + |
| Nucleotide Sequence | GTGGCTGGAACGACAGGAGAACGACCATTTTCCGACATTATTACCAGTGTCCGTTATTGGGTGATTCATAGCATCACCATTCCGGCGTTGTTCATTGCTGGCTGGCTCTTTGTCAGCACCGGTTTGGCCTATGATGTGTTTGGCACCCCACGCCCCGATAGCTACTATGCTCAGGAACAGCGGTCGATTCCTCTTGTGACCGATCGCTTTGAAGCCAAACAACAAGTCGAAACCTTCTTAGAACAGTTGAAGTAG |
| Sequence | MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
| Source of smORF | Swiss-Prot |
| Function | This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_00642, ECO:0000269|Pubmed:20558739, ECO:0000269|Pubmed:21367867, ECO:0000269|Pubmed:25006873}. |
| Pubmed ID | 12240834 17935689 14764885 16049768 16355230 16172937 19219048 20558739 21367867 22665786 23413188 25043005 25006873 |
| Domain | CDD:395221,CDD:395220,CDD:130399 |
| Functional Category | Metal-binding |
| Uniprot ID | Q8DIP0 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1487864 | 1488118 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 2 | 1610317 | 1610571 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 3 | 1354255 | 1354509 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 2182886 | 2183134 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 5 | 3587470 | 3587718 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 6 | 2274288 | 2274536 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 7 | 978068 | 978316 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 8 | 3375117 | 3375365 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 9 | 969898 | 970146 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 10 | 1312942 | 1313190 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 11 | 975392 | 975637 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 12 | 3012403 | 3012648 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 13 | 855814 | 856059 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 14 | 3491455 | 3491700 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 15 | 4429274 | 4429522 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 16 | 6854075 | 6854323 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 17 | 3386601 | 3386849 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 18 | 1496757 | 1497005 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 19 | 3000252 | 3000497 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 20 | 3739528 | 3739776 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 21 | 905406 | 905651 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 22 | 4984224 | 4984469 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 23 | 1431985 | 1432245 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 24 | 2035489 | 2035734 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 25 | 2668656 | 2668907 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 26 | 1103795 | 1104067 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 27 | 5253836 | 5254087 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 28 | 4889840 | 4890085 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 29 | 318588 | 318836 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 30 | 2067287 | 2067541 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 31 | 905698 | 905952 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 32 | 3372254 | 3372511 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP021983.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00283.21 | 0.87 | 27 | 20 | same-strand | Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits |
| 2 | PF01788.19 | 0.68 | 21 | 331 | same-strand | PsbJ |
| 3 | PF14870.8 | 0.87 | 27 | 106 | same-strand | Photosynthesis system II assembly factor YCF48 |
| 4 | PF00301.22 | 0.87 | 27 | 1229 | same-strand | Rubredoxin |
++ More..