Result : Q8D2X9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S15 |
| NCBI Accession ID | BA000021.3 |
| Organism | Wigglesworthia glossinidia brevipalpis |
| Left | 263372 |
| Right | 263641 |
| Strand | - |
| Nucleotide Sequence | ATGTCTCAAAATTTAAAAAAAAAAAATAAATCTTATAAAGAAACTTTACATACTCTTAATATAAAAGAAGATTCTGAAAAACAAATAACTCTTTTGACAGAAAAAATTAAAAGTTTACAAAAACATTTTTTGGAAAATAAAAATGATCTTCATAGCAGAAGAGGTTTATTGAAAAAAGTATCTAGAAGAAGAAAAATATTAAATTACTTAAAAAGAAAAAATAAAATGCGTTATTTTGATCTAATAAAAAAATTAAACTTAAGAAATTAA |
| Sequence | MSQNLKKKNKSYKETLHTLNIKEDSEKQITLLTEKIKSLQKHFLENKNDLHSRRGLLKKVSRRRKILNYLKRKNKMRYFDLIKKLNLRN |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. {ECO:0000255|HAMAP-Rule:MF_01343}.; Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome. {ECO:0000255|HAMAP-Rule:MF_01343}. |
| Pubmed ID | 12219091 |
| Domain | CDD:412325 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8D2X9 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 86
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1916965 | 1917234 | + | NZ_CP014056.2 | Grimontia hollisae |
| 2 | 2250926 | 2251195 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 3 | 3915677 | 3915946 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 4 | 3516900 | 3517169 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 5 | 2332226 | 2332495 | - | NZ_CP033078.1 | Vibrio zhugei |
| 6 | 2851645 | 2851914 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 7 | 1864446 | 1864715 | + | NZ_CP026364.1 | Proteus hauseri |
| 8 | 454818 | 455087 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 9 | 503564 | 503833 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 10 | 3988479 | 3988748 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 11 | 2751210 | 2751479 | - | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 12 | 2891847 | 2892116 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 13 | 1261843 | 1262112 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 14 | 3290407 | 3290676 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 15 | 469874 | 470143 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 16 | 2186282 | 2186551 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 17 | 664260 | 664529 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 18 | 2312728 | 2312997 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 19 | 4052079 | 4052348 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 20 | 3580138 | 3580407 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 21 | 348828 | 349097 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 22 | 3687890 | 3688159 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 23 | 666798 | 667067 | + | NZ_CP025799.1 | Dickeya zeae |
| 24 | 3934536 | 3934805 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 25 | 689085 | 689354 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 26 | 679983 | 680252 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 27 | 2103364 | 2103633 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 28 | 926130 | 926399 | + | NZ_CP022355.1 | Paraphotobacterium marinum |
| 29 | 563048 | 563317 | + | NZ_CP054254.1 | Klebsiella variicola |
| 30 | 419127 | 419396 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 31 | 419849 | 420118 | + | NZ_LR134494.1 | Serratia quinivorans |
| 32 | 3196228 | 3196497 | - | NZ_LS483470.1 | Leminorella richardii |
| 33 | 675532 | 675801 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 34 | 588703 | 588972 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 35 | 3326639 | 3326908 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 36 | 485569 | 485838 | + | NZ_LR134531.1 | Pragia fontium |
| 37 | 580493 | 580762 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 38 | 549336 | 549605 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 39 | 4730424 | 4730693 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 40 | 636913 | 637182 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 41 | 3749248 | 3749517 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 42 | 2849762 | 2850031 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 43 | 379080 | 379349 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 44 | 289354 | 289623 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 45 | 676107 | 676376 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 46 | 1121403 | 1121672 | + | NC_013456.1 | Vibrio antiquarius |
| 47 | 2552722 | 2552991 | - | NZ_CP030788.1 | Vibrio campbellii |
| 48 | 2528213 | 2528482 | + | NZ_CP019959.1 | Vibrio owensii |
| 49 | 2949860 | 2950129 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 50 | 535549 | 535818 | + | NZ_CP041247.1 | Raoultella electrica |
| 51 | 1134950 | 1135219 | - | NZ_CP026047.1 | Raoultella planticola |
| 52 | 588271 | 588540 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 53 | 556069 | 556338 | + | NZ_CP050508.1 | Raoultella terrigena |
| 54 | 695644 | 695913 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 55 | 5286991 | 5287260 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 56 | 487525 | 487794 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 57 | 273262 | 273531 | + | NZ_CP025120.1 | Kangiella profundi |
| 58 | 701639 | 701908 | + | NZ_LT615367.1 | Dickeya aquatica |
| 59 | 313364 | 313633 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 60 | 3344190 | 3344459 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 61 | 2260004 | 2260273 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 62 | 4690295 | 4690564 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 63 | 2400129 | 2400398 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 64 | 3116457 | 3116726 | - | NZ_CP009467.1 | Vibrio harveyi |
| 65 | 323655 | 323924 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 66 | 539271 | 539540 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 67 | 518548 | 518817 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 68 | 295144 | 295413 | + | NZ_CP035688.1 | Vibrio metoecus |
| 69 | 4015398 | 4015667 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 70 | 2725167 | 2725436 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 71 | 1649568 | 1649837 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 72 | 3751292 | 3751561 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 73 | 3839546 | 3839815 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 74 | 1594649 | 1594918 | - | NZ_CP016604.1 | Otariodibacter oris |
| 75 | 4831799 | 4832068 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 76 | 1228325 | 1228594 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 77 | 667100 | 667369 | + | NZ_CP046415.1 | Guyparkeria halophila |
| 78 | 713454 | 713723 | - | NZ_LT615228.1 | Polynucleobacter necessarius |
| 79 | 720564 | 720833 | + | NZ_CP023276.1 | Polynucleobacter difficilis |
| 80 | 996896 | 997165 | - | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 81 | 1060620 | 1060889 | - | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 82 | 1556926 | 1557147 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 83 | 734408 | 734677 | + | NZ_CP007501.1 | Polynucleobacter duraquae |
| 84 | 1697576 | 1697797 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 85 | 395007 | 395276 | - | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
| 86 | 745453 | 745722 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014056.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02576.19 | 0.72 | 62 | 5832.0 | same-strand | RimP N-terminal domain |
| 2 | PF17384.4 | 0.72 | 62 | 5832.0 | same-strand | RimP C-terminal SH3 domain |
| 3 | PF08529.13 | 0.81 | 70 | 4318.0 | same-strand | NusA N-terminal domain |
| 4 | PF13184.8 | 0.81 | 70 | 4318.0 | same-strand | NusA-like KH domain |
| 5 | PF14520.8 | 0.81 | 70 | 4318.0 | same-strand | Helix-hairpin-helix domain |
| 6 | PF11987.10 | 0.85 | 73 | 1601 | same-strand | Translation-initiation factor 2 |
| 7 | PF00009.29 | 0.85 | 73 | 1605.0 | same-strand | Elongation factor Tu GTP binding domain |
| 8 | PF04760.17 | 0.85 | 73 | 1602.0 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 9 | PF08364.13 | 0.83 | 71 | 1597 | same-strand | Bacterial translation initiation factor IF-2 associated region |
| 10 | PF01926.25 | 0.85 | 73 | 1605 | same-strand | 50S ribosome-binding GTPase |
| 11 | PF03144.27 | 0.84 | 72 | 1605 | same-strand | Elongation factor Tu domain 2 |
| 12 | PF02033.20 | 0.85 | 73 | 1092 | same-strand | Ribosome-binding factor A |
| 13 | PF01509.20 | 0.85 | 73 | 148 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
| 14 | PF16198.7 | 0.85 | 73 | 148 | same-strand | tRNA pseudouridylate synthase B C-terminal domain |
| 15 | PF09157.13 | 0.83 | 71 | 148 | same-strand | Pseudouridine synthase II TruB, C-terminal |
| 16 | PF01138.23 | 0.97 | 83 | 257 | same-strand | 3' exoribonuclease family, domain 1 |
| 17 | PF03726.16 | 0.97 | 83 | 257 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
| 18 | PF03725.17 | 0.97 | 83 | 257 | same-strand | 3' exoribonuclease family, domain 2 |
| 19 | PF00575.25 | 0.97 | 83 | 304 | same-strand | S1 RNA binding domain |
| 20 | PF00013.31 | 0.97 | 83 | 257 | same-strand | KH domain |
| 21 | PF00515.30 | 0.67 | 58 | 2519.0 | same-strand | Tetratricopeptide repeat |
++ More..