Result : Q8D2V0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0434 protein WIGBR2520 |
| NCBI Accession ID | BA000021.3 |
| Organism | Wigglesworthia glossinidia brevipalpis |
| Left | 295563 |
| Right | 295733 |
| Strand | - |
| Nucleotide Sequence | ATGGATAAAAAATTGTTAAATATAATTGCTTGTCCAATCTGTAATAAAAAATTAAATTTTGATTTGATTAGAAAAGAACTTATTTGTGAATTTGATTCAGTAGCTTTTCCAATAAAAGATGGAATTCCAATTTTGCTTAGGGATTCCAGTTATCCTATTAAAAAAAGGTAA |
| Sequence | MDKKLLNIIACPICNKKLNFDLIRKELICEFDSVAFPIKDGIPILLRDSSYPIKKR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01066. Profile Description: Trm112p-like protein. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C-terminus contains the strongest conservation. Trm112p is required for tRNA methylation in S. cerevisiae and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices. |
| Pubmed ID | 12219091 |
| Domain | CDD:412721 |
| Functional Category | Others |
| Uniprot ID | Q8D2V0 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 199
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 546362 | 546526 | + | NC_016893.1 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans morsitans (Yale colony) |
| 2 | 550594 | 550773 | - | NZ_CP037953.1 | Permianibacter aggregans |
| 3 | 2921670 | 2921852 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 4 | 3379203 | 3379385 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 5 | 1889273 | 1889455 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 6 | 3855203 | 3855385 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 7 | 1681166 | 1681348 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 8 | 2570145 | 2570327 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 9 | 1556528 | 1556710 | + | NC_015968.1 | Enterobacter soli |
| 10 | 1572681 | 1572860 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 11 | 3010738 | 3010920 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 12 | 2179059 | 2179238 | + | NZ_CP029736.1 | Providencia rettgeri |
| 13 | 735658 | 735837 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 14 | 1608032 | 1608214 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 15 | 1694977 | 1695159 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 16 | 1588817 | 1588999 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 17 | 1571975 | 1572157 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 18 | 958172 | 958354 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 19 | 777128 | 777310 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 20 | 1865081 | 1865263 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 21 | 1805178 | 1805360 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 22 | 2884508 | 2884690 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 23 | 2694344 | 2694526 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 24 | 419556 | 419726 | + | NC_002971.4 | Coxiella burnetii RSA 493 |
| 25 | 3767633 | 3767815 | - | NZ_CP050508.1 | Raoultella terrigena |
| 26 | 1546011 | 1546193 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 27 | 3239524 | 3239706 | + | NZ_CP065640.1 | Serratia rubidaea |
| 28 | 1847857 | 1848039 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 29 | 1992799 | 1992981 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 30 | 3511092 | 3511274 | + | NZ_CP053416.1 | Salmonella bongori |
| 31 | 637239 | 637421 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 32 | 2167732 | 2167914 | + | NZ_CP025799.1 | Dickeya zeae |
| 33 | 4015354 | 4015536 | + | NZ_CP011254.1 | Serratia fonticola |
| 34 | 993375 | 993557 | + | NZ_AP014857.1 | Escherichia albertii |
| 35 | 3190185 | 3190367 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 36 | 3632708 | 3632890 | - | NZ_CP054254.1 | Klebsiella variicola |
| 37 | 1795558 | 1795737 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 38 | 137772 | 137948 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 39 | 2597383 | 2597565 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 40 | 4478888 | 4479070 | + | NZ_CP033744.1 | Citrobacter freundii |
| 41 | 1865061 | 1865219 | + | NZ_CP046378.1 | Shewanella algae |
| 42 | 1438240 | 1438422 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 43 | 3036704 | 3036886 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 44 | 4301649 | 4301831 | + | NZ_CP049115.1 | Pantoea stewartii |
| 45 | 4135224 | 4135406 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 46 | 1831586 | 1831723 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 47 | 3983925 | 3984107 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 48 | 2748658 | 2748840 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 49 | 3415998 | 3416180 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 50 | 1617600 | 1617782 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 51 | 4024974 | 4025156 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 52 | 2446257 | 2446445 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 53 | 2928416 | 2928598 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 54 | 3843485 | 3843667 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 55 | 1470936 | 1471118 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 56 | 954458 | 954640 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 57 | 970673 | 970855 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 58 | 4249093 | 4249275 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 59 | 1100316 | 1100498 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 60 | 1377071 | 1377253 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 61 | 2747127 | 2747309 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 62 | 1829950 | 1830132 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 63 | 1708439 | 1708621 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 64 | 1546603 | 1546785 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 65 | 1644571 | 1644753 | + | NZ_LR134340.1 | Escherichia marmotae |
| 66 | 3229988 | 3230170 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 67 | 3861626 | 3861808 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 68 | 3015361 | 3015543 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 69 | 1296249 | 1296431 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 70 | 3482261 | 3482443 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 71 | 44686 | 44868 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 72 | 1448565 | 1448744 | + | NZ_CP046268.1 | Vibrio spartinae |
| 73 | 2463356 | 2463547 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 74 | 1857606 | 1857788 | + | NZ_LT906479.1 | Serratia ficaria |
| 75 | 498832 | 499014 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 76 | 4375549 | 4375731 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 77 | 2224232 | 2224414 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 78 | 586521 | 586703 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 79 | 1532169 | 1532348 | - | NZ_CP035688.1 | Vibrio metoecus |
| 80 | 1875668 | 1875847 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 81 | 2831379 | 2831561 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 82 | 1874859 | 1875047 | - | NZ_CP040449.1 | Aeromonas simiae |
| 83 | 3077500 | 3077676 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 84 | 2100241 | 2100423 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 85 | 2976835 | 2977017 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 86 | 2375563 | 2375736 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 87 | 2322528 | 2322710 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 88 | 826828 | 827007 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 89 | 1951264 | 1951443 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 90 | 1592495 | 1592674 | + | NZ_CP040990.1 | Vibrio furnissii |
| 91 | 1738408 | 1738590 | - | NZ_CP038469.1 | Citrobacter tructae |
| 92 | 1767376 | 1767558 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 93 | 3479368 | 3479550 | - | NZ_CP041247.1 | Raoultella electrica |
| 94 | 2161679 | 2161861 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 95 | 2608316 | 2608456 | - | NC_007954.1 | Shewanella denitrificans OS217 |
| 96 | 2847796 | 2847942 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 97 | 2488387 | 2488569 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 98 | 3649344 | 3649526 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 99 | 2155987 | 2156169 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 100 | 3232088 | 3232270 | - | NZ_CP071320.1 | Serratia ureilytica |
| 101 | 1581584 | 1581766 | + | NZ_CP061511.1 | Mixta calida |
| 102 | 3123122 | 3123301 | - | NZ_CP048796.1 | Providencia vermicola |
| 103 | 1074488 | 1074670 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 104 | 2049221 | 2049403 | - | NZ_CP065534.1 | Lonsdalea populi |
| 105 | 2252294 | 2252473 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 106 | 3595455 | 3595637 | + | NZ_CP026047.1 | Raoultella planticola |
| 107 | 1939055 | 1939234 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 108 | 2252494 | 2252670 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 109 | 39665 | 39847 | - | NZ_CP019706.1 | Pantoea alhagi |
| 110 | 895815 | 895997 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 111 | 2726802 | 2726984 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 112 | 3256265 | 3256444 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 113 | 3672683 | 3672862 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 114 | 2466931 | 2467113 | - | NZ_LR134531.1 | Pragia fontium |
| 115 | 2083525 | 2083704 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 116 | 1084715 | 1084897 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 117 | 3296846 | 3297028 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 118 | 2159750 | 2159932 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 119 | 1818515 | 1818697 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 120 | 2092390 | 2092572 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 121 | 3689525 | 3689707 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 122 | 1396312 | 1396488 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 123 | 3698744 | 3698923 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 124 | 1124503 | 1124685 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 125 | 1649502 | 1649681 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 126 | 3057973 | 3058155 | - | NZ_LR134201.1 | Cedecea lapagei |
| 127 | 2325231 | 2325410 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 128 | 2155015 | 2155188 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 129 | 2207076 | 2207258 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 130 | 2140413 | 2140595 | + | NZ_LT615367.1 | Dickeya aquatica |
| 131 | 2117610 | 2117789 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 132 | 2306836 | 2307015 | - | NZ_AP014635.1 | Vibrio tritonius |
| 133 | 1125411 | 1125590 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 134 | 1684658 | 1684837 | - | NZ_AP019657.1 | Vibrio ponticus |
| 135 | 1576965 | 1577144 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 136 | 1678819 | 1678995 | + | NZ_CP050150.1 | Hafnia alvei |
| 137 | 2063621 | 2063803 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 138 | 38682 | 38861 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 139 | 3680715 | 3680897 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 140 | 2951870 | 2952013 | - | NZ_CP020472.1 | Shewanella japonica |
| 141 | 1021517 | 1021696 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 142 | 2630233 | 2630412 | - | NC_013456.1 | Vibrio antiquarius |
| 143 | 818496 | 818678 | + | NZ_CP028271.1 | Mixta intestinalis |
| 144 | 2774905 | 2775087 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 145 | 1699874 | 1700053 | - | NZ_CP033078.1 | Vibrio zhugei |
| 146 | 832637 | 832819 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 147 | 2915677 | 2915847 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 148 | 3122353 | 3122499 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 149 | 1767961 | 1768140 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 150 | 993398 | 993577 | + | NZ_CP030788.1 | Vibrio campbellii |
| 151 | 2038292 | 2038471 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 152 | 789562 | 789741 | - | NZ_CP019959.1 | Vibrio owensii |
| 153 | 1279244 | 1279423 | + | NZ_CP009467.1 | Vibrio harveyi |
| 154 | 1178760 | 1178939 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 155 | 2703065 | 2703211 | - | NZ_CP041036.1 | Shewanella polaris |
| 156 | 1933018 | 1933200 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 157 | 1860069 | 1860248 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 158 | 2860944 | 2861123 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 159 | 1283197 | 1283376 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 160 | 2885653 | 2885832 | + | NZ_CP026364.1 | Proteus hauseri |
| 161 | 792440 | 792619 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 162 | 1190165 | 1190308 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 163 | 1019634 | 1019813 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 164 | 1409374 | 1409556 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 165 | 1386851 | 1387036 | + | NZ_CP028901.1 | Algicoccus marinus |
| 166 | 1692350 | 1692535 | + | NZ_CP041730.1 | Chitinimonas arctica |
| 167 | 3371735 | 3371917 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 168 | 1534941 | 1535123 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 169 | 3413044 | 3413184 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 170 | 1208180 | 1208353 | + | NZ_CP022355.1 | Paraphotobacterium marinum |
| 171 | 940177 | 940359 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 172 | 1358608 | 1358793 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 173 | 1772311 | 1772454 | + | NZ_CP037951.1 | Parashewanella tropica |
| 174 | 99774 | 99956 | - | NZ_LR134418.1 | Legionella adelaidensis |
| 175 | 320145 | 320327 | - | NZ_CP029495.1 | Chromobacterium phragmitis |
| 176 | 1632514 | 1632696 | - | NZ_CP017707.1 | Chromobacterium vaccinii |
| 177 | 2234318 | 2234500 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 178 | 471127 | 471294 | - | NZ_CP021377.1 | Oceanisphaera profunda |
| 179 | 1459209 | 1459394 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 180 | 2596706 | 2596873 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 181 | 1284741 | 1284920 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 182 | 1317975 | 1318160 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 183 | 1076330 | 1076506 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 184 | 3642952 | 3643134 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 185 | 2348395 | 2348577 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 186 | 1132450 | 1132629 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 187 | 2401436 | 2401618 | - | NZ_CP043473.1 | Chromobacterium paludis |
| 188 | 1189655 | 1189840 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 189 | 2123652 | 2123831 | - | NZ_LT906451.1 | Legionella lansingensis |
| 190 | 943288 | 943467 | + | NZ_LN681225.1 | Legionella hackeliae |
| 191 | 843416 | 843595 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 192 | 2821246 | 2821425 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 193 | 2391364 | 2391543 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 194 | 1273697 | 1273876 | - | NZ_LR134374.1 | Legionella spiritensis |
| 195 | 802160 | 802339 | + | NZ_CP038254.1 | Legionella israelensis |
| 196 | 1035563 | 1035742 | + | NZ_LN614830.1 | Tatlockia micdadei |
| 197 | 728570 | 728749 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 198 | 1161673 | 1161855 | + | NZ_CP013341.1 | Nitrosomonas ureae |
| 199 | 1447170 | 1447340 | - | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 200 | 1407897 | 1408076 | + | NZ_LT906442.1 | Legionella waltersii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP037953.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00664.25 | 0.79 | 158 | 1673 | same-strand | ABC transporter transmembrane region |
| 2 | PF00005.29 | 0.8 | 160 | 1848 | same-strand | ABC transporter |
| 3 | PF02348.21 | 0.87 | 174 | -3 | same-strand | Cytidylyltransferase |
| 4 | PF02606.16 | 0.9 | 179 | 347.5 | same-strand | Tetraacyldisaccharide-1-P 4'-kinase |
| 5 | PF03772.18 | 0.78 | 156 | 3561 | same-strand | Competence protein |
| 6 | PF00753.29 | 0.76 | 152 | 3547.5 | same-strand | Metallo-beta-lactamase superfamily |
++ More..