ProsmORF-pred
Result : A9CHM9
Protein Information
Information Type Description
Protein name Aminoacyl carrier protein
NCBI Accession ID AE007869.2
Organism Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Left 2542120
Right 2542371
Strand +
Nucleotide Sequence ATGAATGCGACTATTCGTGAAATACTGGCAAAATTCGGCCAGCTTCCCACCCCCGTCGATACGATTGCAGATGAAGCAGATCTTTATGCGGCAGGCCTCTCTTCCTTCGCATCCGTACAACTGATGTTGGGTATCGAAGAAGCATTCGATATCGAATTCCCCGATAACCTGTTGAACCGCAAGTCTTTCGCCAGCATCAAGGCCATTGAAGACACCGTTAAGCTCATTCTGGATGGTAAAGAGGCTGCCTGA
Sequence MNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLILDGKEAA
Source of smORF Swiss-Prot
Function Aminoacyl carrier protein. Can be charged with L-alanine, L-glycine or L-serine, via the formation of a thioester bond between the amino acid and the 4'-phosphopantetheinyl prosthetic group, catalyzed by the Atu2573 ligase. {ECO:0000269|Pubmed:20663952}.
Pubmed ID 11743193 11743194 20663952
Domain CDD:415812
Functional Category Others
Uniprot ID A9CHM9
ORF Length (Amino Acid) 83
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 47
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2194975 2195226 + NZ_CP053856.1 Rhizobium pusense
2 2303537 2303788 + NZ_CP061003.1 Agrobacterium tumefaciens
3 2536595 2536846 - NZ_CP048632.1 Rhizobium oryzihabitans
4 4368622 4368873 - NZ_CP032694.1 Rhizobium jaguaris
5 4268202 4268453 + NZ_CP071612.1 Rhizobium bangladeshense
6 4421912 4422163 + NZ_CP071604.1 Rhizobium binae
7 4197751 4198002 + NZ_CP020906.1 Rhizobium etli
8 4371839 4372090 + NZ_CP013500.1 Rhizobium esperanzae
9 3975963 3976214 - NZ_CP006877.1 Rhizobium gallicum bv. gallicum R602sp
10 1714573 1714824 + NZ_CP071454.1 Rhizobium lentis
11 3979550 3979801 - NZ_CP034998.1 Rhizobium acidisoli
12 3622402 3622653 - NC_020059.1 Rhizobium tropici CIAT 899
13 4433061 4433312 + NZ_CP013532.1 Rhizobium phaseoli
14 138404 138655 + NZ_CP054027.1 Rhizobium hidalgonense
15 265935 266186 + NZ_CP006879.1 Rhizobium gallicum bv. gallicum R602sp
16 552706 552957 - NZ_CP034999.1 Rhizobium acidisoli
17 2850881 2851132 + NZ_CP054021.1 Rhizobium indicum
18 4865819 4866070 - NZ_CP071678.1 Rhizobium ruizarguesonis
19 357164 357415 - NZ_CP059896.1 Ciceribacter thiooxidans
20 1873784 1874035 + NZ_CP064063.1 Brucella anthropi
21 276215 276466 + NZ_CP071608.1 Rhizobium binae
22 1501583 1501834 + NZ_CP049241.1 Rhizobium pseudoryzae
23 4032708 4032959 + NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
24 3524084 3524323 - NZ_CP046908.1 Stappia indica
25 8416 8664 - NZ_CP049248.1 Rhizobium rhizoryzae
26 8692 8943 - NZ_CP054624.1 Cupriavidus gilardii
27 44234 44482 + NZ_CP029834.1 Azospirillum ramasamyi
28 137208 137459 + NZ_CP053708.1 Lichenicola cladoniae
29 1200972 1201223 + NZ_CP066075.1 Paraburkholderia ginsengisoli
30 364119 364367 + NZ_CP054620.1 Azospirillum oryzae
31 1114435 1114686 + NZ_CP039690.1 Phreatobacter stygius
32 1460588 1460839 - NZ_CP027668.1 Phreatobacter cathodiphilus
33 415726 415953 - NZ_CP012406.1 Azospirillum thiophilum
34 2141489 2141740 - NC_007951.1 Paraburkholderia xenovorans LB400
35 3667759 3668010 + NZ_CP022989.1 Paraburkholderia aromaticivorans
36 2513361 2513606 - NZ_CP047650.1 Xylophilus rhododendri
37 4524465 4524683 - NZ_AP023172.1 Rhodococcus qingshengii
38 10755 11006 + NZ_CP062804.1 Cupriavidus basilensis
39 4634957 4635199 - NZ_CP024645.1 Rhizobacter gummiphilus
40 935166 935411 - NZ_CP042430.1 Baekduia soli
41 2052483 2052710 - NZ_CP029553.1 Methylobacterium terrae
42 184849 185103 + NC_010505.1 Methylobacterium radiotolerans JCM 2831
43 5515936 5516190 + NZ_CP015367.1 Methylobacterium phyllosphaerae
44 184668 184922 + NZ_CP003811.1 Methylobacterium oryzae CBMB20
45 1226277 1226528 - NZ_CP013403.1 Burkholderia metallica
46 1206048 1206299 - NZ_CP013461.1 Burkholderia stagnalis
47 1306836 1307087 - NZ_CP013400.1 Burkholderia seminalis
48 1397463 1397714 - NZ_CP013452.1 Burkholderia cenocepacia
49 1253674 1253925 + NZ_CP045236.1 Burkholderia cepacia
50 389265 389558 + NZ_CP029352.1 Azospirillum thermophilum
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP053856.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF08893.12 1.0 47 2104.0 same-strand Domain of unknown function (DUF1839)
++ More..