| Protein name |
FAD assembly factor SdhE |
| NCBI Accession ID |
BA000021.3 |
| Organism |
Wigglesworthia glossinidia brevipalpis |
| Left |
508908 |
| Right |
509162 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAAAATAAAAAATAAATCTATGGTTTATTGGTCTTGCAGAAGAGGAATGTTAGAGTTAGATATTATAATTAATAATTTCTTTAAAAAAGAATTTGATTTTTTATCAAATAAAGAAAAAATTTTTTTTGTTAATATGTTAAGTTACGATGATATTTATCTGTATAAGTGTCTTATTTTTAATTATGAACCAAAAAACAAAAAAATAAAAAAAATTATCAAATTAATAAAAAGAAGTTCTTTTTCATTTTCATAA |
| Sequence |
MKIKNKSMVYWSCRRGMLELDIIINNFFKKEFDFLSNKEKIFFVNMLSYDDIYLYKCLIFNYEPKNKKIKKIIKLIKRSSFSFS |
| Source of smORF |
Swiss-Prot |
| Function |
An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID |
12219091
|
| Domain |
CDD:412748 |
| Functional Category |
Others |
| Uniprot ID |
Q8D2B6
|
| ORF Length (Amino Acid) |
84 |