Result : Q8CWR8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L33 1 |
| NCBI Accession ID | AE007317.1 |
| Organism | Streptococcus pneumoniae (strain ATCC BAA-255 / R6) |
| Left | 867410 |
| Right | 867559 |
| Strand | + |
| Nucleotide Sequence | GTGCGAGTAAAAATTAATCTCAAATGCTCCTCTTGTGACAGTATCAATTACCTAACCAGTAAAAATTCAAAAACCCATCCAGACAAGATTGAGGTTTTAAAGTATTGTCCCAAGGAAAGAAAAGTAACCCTACATCTTGAATCTAAGTAG |
| Sequence | MRVKINLKCSSCDSINYLTSKNSKTHPDKIEVLKYCPKERKVTLHLESK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 11544234 |
| Domain | CDD:412348 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8CWR8 |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 346
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 931337 | 931486 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 2 | 667704 | 667853 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 3 | 745458 | 745607 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 4 | 631040 | 631189 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 5 | 737240 | 737389 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 6 | 865931 | 866080 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 7 | 827787 | 827936 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 8 | 1339752 | 1339901 | - | NC_012924.1 | Streptococcus suis SC84 |
| 9 | 1053403 | 1053552 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 10 | 547611 | 547760 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 11 | 1804224 | 1804373 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 12 | 1372783 | 1372929 | - | NZ_LS483343.1 | Streptococcus ferus |
| 13 | 1360388 | 1360537 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 14 | 1315106 | 1315252 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 15 | 83185 | 83334 | + | NZ_LT906439.1 | Streptococcus merionis |
| 16 | 1383571 | 1383720 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 17 | 1742867 | 1743013 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 18 | 1200788 | 1200937 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 19 | 234988 | 235134 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 20 | 1441158 | 1441304 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 21 | 642300 | 642446 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 22 | 511713 | 511859 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 23 | 1555258 | 1555404 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 24 | 1287354 | 1287500 | + | NZ_CP043405.1 | Streptococcus ratti |
| 25 | 1778458 | 1778604 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 26 | 110080 | 110226 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 27 | 672396 | 672542 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 28 | 93995 | 94141 | + | NZ_CP013237.1 | Streptococcus mutans |
| 29 | 477625 | 477771 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 30 | 496968 | 497114 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 31 | 1836399 | 1836545 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 32 | 1357768 | 1357914 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 33 | 542234 | 542380 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 34 | 53112 | 53258 | - | NZ_LR134293.1 | Streptococcus canis |
| 35 | 409651 | 409797 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 36 | 509123 | 509269 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 37 | 557906 | 558052 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 38 | 556998 | 557144 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 39 | 1647608 | 1647760 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 40 | 745459 | 745605 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 41 | 114061 | 114207 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 42 | 601008 | 601154 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 43 | 1713901 | 1714050 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 44 | 1470859 | 1471008 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 45 | 984158 | 984307 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 46 | 1046443 | 1046592 | + | NZ_CP065211.1 | Enterococcus lactis |
| 47 | 1699003 | 1699152 | + | NZ_CP023011.2 | Enterococcus hirae |
| 48 | 3530151 | 3530300 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 49 | 1665571 | 1665720 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 50 | 1633868 | 1634017 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 51 | 1962918 | 1963064 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 52 | 1138950 | 1139099 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 53 | 382593 | 382742 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 54 | 1779703 | 1779852 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 55 | 1127430 | 1127579 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 56 | 632372 | 632521 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 57 | 529989 | 530138 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 58 | 1364720 | 1364869 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 59 | 480425 | 480574 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 60 | 949825 | 949974 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 61 | 1837503 | 1837655 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 62 | 805577 | 805726 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 63 | 1126470 | 1126619 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 64 | 2887026 | 2887175 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 65 | 781977 | 782126 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 66 | 2947514 | 2947663 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 67 | 1749164 | 1749313 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 68 | 7185 | 7334 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 69 | 2336081 | 2336230 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 70 | 2165083 | 2165232 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 71 | 1310405 | 1310554 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 72 | 1046611 | 1046760 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 73 | 2984640 | 2984789 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 74 | 616315 | 616464 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 75 | 2020124 | 2020273 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 76 | 1187180 | 1187329 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 77 | 1297547 | 1297696 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 78 | 1678000 | 1678149 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 79 | 1460106 | 1460255 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 80 | 1041618 | 1041767 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 81 | 1658050 | 1658199 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 82 | 1848522 | 1848671 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 83 | 2475502 | 2475651 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 84 | 3462685 | 3462834 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 85 | 1791822 | 1791971 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 86 | 1115584 | 1115733 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 87 | 846731 | 846880 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 88 | 3399157 | 3399306 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 89 | 692608 | 692757 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 90 | 2320396 | 2320545 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 91 | 584902 | 585051 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 92 | 690720 | 690869 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 93 | 1268948 | 1269097 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 94 | 804132 | 804281 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 95 | 1240146 | 1240295 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 96 | 2527408 | 2527557 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 97 | 1961545 | 1961694 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 98 | 734177 | 734326 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 99 | 1403525 | 1403674 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 100 | 1070311 | 1070460 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 101 | 970200 | 970349 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 102 | 583636 | 583785 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 103 | 1099087 | 1099236 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 104 | 621745 | 621903 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 105 | 651917 | 652066 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 106 | 908796 | 908945 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 107 | 172883 | 173032 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 108 | 2089167 | 2089316 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 109 | 1317294 | 1317452 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 110 | 1277847 | 1277996 | + | NZ_LR134483.1 | Listeria grayi |
| 111 | 1273075 | 1273224 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 112 | 1342344 | 1342493 | + | NZ_LT906444.1 | Listeria welshimeri |
| 113 | 1390201 | 1390350 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 114 | 1363826 | 1363975 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 115 | 768871 | 769020 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 116 | 696112 | 696261 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 117 | 4261152 | 4261301 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 118 | 1268878 | 1269036 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 119 | 1789334 | 1789483 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 120 | 3321669 | 3321818 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 121 | 2292784 | 2292936 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 122 | 2148214 | 2148363 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 123 | 1205408 | 1205557 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 124 | 2147478 | 2147627 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 125 | 826439 | 826588 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 126 | 1563390 | 1563539 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 127 | 370009 | 370158 | - | NZ_CP046314.1 | Gemella morbillorum |
| 128 | 1399590 | 1399739 | - | NZ_LR134484.1 | Gemella haemolysans |
| 129 | 1378223 | 1378381 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 130 | 2978789 | 2978938 | - | NZ_CP053989.1 | Niallia circulans |
| 131 | 816074 | 816223 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 132 | 552781 | 552930 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 133 | 2849721 | 2849870 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 134 | 980973 | 981122 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 135 | 1573751 | 1573900 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 136 | 1812501 | 1812650 | - | NZ_CP027770.1 | Staphylococcus felis |
| 137 | 2342176 | 2342325 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 138 | 1125671 | 1125820 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 139 | 548179 | 548328 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 140 | 455016 | 455174 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 141 | 407181 | 407339 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 142 | 2017671 | 2017820 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 143 | 191125 | 191256 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 144 | 1710639 | 1710788 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 145 | 603719 | 603868 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 146 | 1108823 | 1108972 | - | NZ_CP047361.1 | Macrococcus canis |
| 147 | 4255990 | 4256139 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 148 | 1539245 | 1539394 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 149 | 3108048 | 3108197 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 150 | 289796 | 289945 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 151 | 1795875 | 1796024 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 152 | 326749 | 326907 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 153 | 2353708 | 2353866 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 154 | 3034286 | 3034438 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 155 | 1535048 | 1535197 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 156 | 2925993 | 2926142 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 157 | 1082223 | 1082372 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 158 | 1952838 | 1952987 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 159 | 7294 | 7443 | + | NZ_CP045296.1 | Paenibacillus cellulositrophicus |
| 160 | 1409375 | 1409533 | - | NZ_CP053826.1 | Campylobacter curvus |
| 161 | 1328940 | 1329089 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 162 | 504374 | 504532 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 163 | 370803 | 370961 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 164 | 2637648 | 2637815 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 165 | 1227864 | 1228016 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 166 | 478238 | 478396 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 167 | 453617 | 453775 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 168 | 2037780 | 2037929 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 169 | 3317734 | 3317883 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 170 | 2415526 | 2415696 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 171 | 2814008 | 2814157 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 172 | 621004 | 621162 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 173 | 350767 | 350925 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 174 | 2993505 | 2993654 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 175 | 165534 | 165683 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 176 | 1089178 | 1089336 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 177 | 1309116 | 1309274 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 178 | 316235 | 316393 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 179 | 1981237 | 1981386 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 180 | 460412 | 460579 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 181 | 1579093 | 1579260 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 182 | 1693553 | 1693702 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 183 | 128363 | 128512 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 184 | 1872491 | 1872640 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 185 | 3115072 | 3115221 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 186 | 125451 | 125621 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 187 | 54285 | 54443 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 188 | 435660 | 435818 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 189 | 3111068 | 3111217 | - | NZ_CP016538.2 | Planococcus maritimus |
| 190 | 3140252 | 3140401 | - | NZ_CP059540.1 | Planococcus maritimus |
| 191 | 3097446 | 3097595 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 192 | 2998637 | 2998786 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 193 | 2133019 | 2133186 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 194 | 1503813 | 1503980 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 195 | 885668 | 885817 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 196 | 134056 | 134205 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 197 | 819668 | 819826 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 198 | 2654555 | 2654692 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 199 | 447816 | 447983 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 200 | 318407 | 318577 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 201 | 584489 | 584659 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 202 | 410131 | 410289 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 203 | 449093 | 449260 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 204 | 2274453 | 2274620 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 205 | 1652467 | 1652637 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 206 | 1668630 | 1668803 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 207 | 1774493 | 1774663 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 208 | 50167 | 50325 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 209 | 391149 | 391307 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 210 | 399052 | 399210 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 211 | 414076 | 414234 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 212 | 422516 | 422674 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 213 | 427601 | 427759 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 214 | 1107501 | 1107659 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 215 | 2365649 | 2365819 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 216 | 355622 | 355780 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 217 | 1701820 | 1701990 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 218 | 571944 | 572093 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 219 | 971343 | 971492 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 220 | 841073 | 841222 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 221 | 3227364 | 3227513 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 222 | 575388 | 575537 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 223 | 2334328 | 2334495 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 224 | 2387325 | 2387492 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 225 | 909 | 1079 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 226 | 2517405 | 2517572 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 227 | 2309451 | 2309618 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 228 | 2605906 | 2606076 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 229 | 1457833 | 1457982 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 230 | 1394814 | 1394972 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 231 | 125626 | 125775 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 232 | 1208797 | 1208946 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 233 | 337420 | 337569 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 234 | 2273475 | 2273624 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 235 | 413590 | 413739 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 236 | 2035161 | 2035337 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 237 | 2242700 | 2242867 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 238 | 2679474 | 2679641 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 239 | 2137052 | 2137222 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 240 | 2262301 | 2262471 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 241 | 745339 | 745476 | - | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 242 | 2332177 | 2332344 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 243 | 542094 | 542243 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 244 | 528847 | 528996 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 245 | 195493 | 195645 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 246 | 510667 | 510837 | + | NZ_CP012544.1 | Campylobacter showae |
| 247 | 1915853 | 1916023 | - | NZ_CP012543.1 | Campylobacter rectus |
| 248 | 1393141 | 1393290 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 249 | 662118 | 662279 | - | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 250 | 1389102 | 1389251 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 251 | 1664967 | 1665116 | - | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 252 | 53596 | 53745 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 253 | 3783094 | 3783243 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 254 | 2970787 | 2970936 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 255 | 1055531 | 1055680 | + | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 256 | 1304305 | 1304454 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 257 | 398649 | 398798 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 258 | 1980079 | 1980228 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 259 | 2030760 | 2030909 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 260 | 2310388 | 2310537 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 261 | 3218132 | 3218284 | + | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 262 | 113063 | 113227 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 263 | 2369204 | 2369353 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 264 | 2554443 | 2554616 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 265 | 759097 | 759246 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 266 | 1483200 | 1483349 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 267 | 324517 | 324666 | + | NC_022549.1 | Acholeplasma brassicae |
| 268 | 65194 | 65343 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 269 | 302115 | 302267 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 270 | 3975715 | 3975864 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 271 | 328325 | 328462 | + | NZ_CP054142.1 | Treponema parvum |
| 272 | 250061 | 250210 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 273 | 756165 | 756335 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 274 | 148332 | 148484 | + | NC_012115.1 | Nautilia profundicola AmH |
| 275 | 1698610 | 1698759 | - | NZ_LT906470.1 | Veillonella rodentium |
| 276 | 1695318 | 1695467 | - | NZ_LR134375.1 | Veillonella dispar |
| 277 | 1757056 | 1757205 | - | NZ_LR778174.1 | Veillonella parvula |
| 278 | 1640024 | 1640173 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 279 | 3972609 | 3972758 | - | NZ_CP019870.1 | Clostridioides difficile |
| 280 | 12708 | 12860 | - | NZ_AP014631.1 | Mycoplasma canadense |
| 281 | 364912 | 365082 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 282 | 359396 | 359566 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 283 | 1591704 | 1591874 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 284 | 2329863 | 2330012 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 285 | 598515 | 598667 | + | NZ_CP034044.1 | Mycoplasma struthionis |
| 286 | 5305805 | 5305954 | - | NZ_CP020953.1 | Clostridium drakei |
| 287 | 4455426 | 4455575 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 288 | 4618252 | 4618401 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 289 | 91153 | 91305 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 290 | 2188463 | 2188612 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 291 | 3287770 | 3287919 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 292 | 3092101 | 3092253 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 293 | 631764 | 631913 | + | NZ_CP014176.1 | Clostridium argentinense |
| 294 | 511376 | 511537 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 295 | 2444444 | 2444593 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 296 | 497865 | 498014 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 297 | 491027 | 491176 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 298 | 825744 | 825893 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 299 | 2915978 | 2916127 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 300 | 1533256 | 1533405 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 301 | 2140336 | 2140485 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 302 | 1412753 | 1412902 | - | NZ_CP029256.1 | Christensenella minuta |
| 303 | 1238927 | 1239076 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 304 | 2843243 | 2843404 | - | NZ_CP048649.1 | Aminipila butyrica |
| 305 | 1251976 | 1252125 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 306 | 2342340 | 2342483 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 307 | 4577857 | 4578006 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 308 | 484368 | 484517 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 309 | 431894 | 432046 | - | NZ_CP030103.1 | Mycoplasma cloacale |
| 310 | 1266640 | 1266789 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 311 | 1063653 | 1063802 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 312 | 465416 | 465586 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 313 | 2441062 | 2441211 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 314 | 578363 | 578515 | - | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 315 | 2679510 | 2679659 | - | NZ_HG917868.1 | Clostridium bornimense |
| 316 | 2456212 | 2456382 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 317 | 176091 | 176243 | - | NZ_LR214938.2 | Mycoplasma salivarium |
| 318 | 784276 | 784428 | - | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 319 | 175265 | 175435 | - | NZ_CP009228.1 | Treponema putidum |
| 320 | 228665 | 228814 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 321 | 460964 | 461113 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 322 | 471072 | 471221 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 323 | 3698829 | 3698978 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 324 | 261457 | 261609 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 325 | 4243541 | 4243690 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 326 | 380319 | 380483 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 327 | 344373 | 344525 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 328 | 392647 | 392793 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 329 | 256864 | 257016 | + | NZ_CP029295.1 | Mycoplasma phocidae |
| 330 | 997538 | 997690 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 331 | 348082 | 348234 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 332 | 408793 | 408954 | - | NC_000908.2 | Mycoplasma genitalium G37 |
| 333 | 2714930 | 2715067 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 334 | 1800956 | 1801105 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 335 | 408460 | 408588 | + | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 336 | 753580 | 753726 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 337 | 214281 | 214430 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 338 | 492276 | 492443 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 339 | 1318020 | 1318157 | - | NZ_CP059443.1 | Campylobacter fetus |
| 340 | 675949 | 676107 | + | NZ_CP012541.1 | Campylobacter concisus |
| 341 | 2191504 | 2191653 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 342 | 2563046 | 2563189 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 343 | 1466027 | 1466164 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 344 | 1195172 | 1195312 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 345 | 446976 | 447149 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 346 | 448082 | 448249 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 347 | 375426 | 375575 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 348 | 2115299 | 2115448 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 349 | 2895251 | 2895400 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 350 | 1584979 | 1585128 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 351 | 705338 | 705487 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 352 | 744565 | 744717 | + | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 353 | 866529 | 866681 | + | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 354 | 1027703 | 1027855 | + | NZ_CP024161.1 | Mycoplasma dispar |
++ More..