Result : Q8CUT7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein P (SASP P) |
| NCBI Accession ID | BA000028.3 |
| Organism | Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
| Left | 1062280 |
| Right | 1062432 |
| Strand | + |
| Nucleotide Sequence | ATGTCAAAAAGAAAGATGGGGCCAAAACAACAAAAAAATCCAGAACTGCCAAAAAGTCCCGAACAACCATATGGTGAACCATTAAGCGGATCAAAAAAAGAAAAAAAGGCAAATCATTCAGGACAAAAACATAATCCACACCATGGTTTATAA |
| Sequence | MSKRKMGPKQQKNPELPKSPEQPYGEPLSGSKKEKKANHSGQKHNPHHGL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23918. Profile Description: Small acid-soluble spore protein P family. This family consists of the small acid-soluble spore proteins (SASP) P type (sspP). sspP is expressed only in the forespore compartment of the sporulating cell. sspP is also expressed under sigma-G control from the same promoter as sspO. Mutations deleting sspP causes no discernible effect on sporulation, spore properties or spore germination. |
| Pubmed ID | 12235376 |
| Domain | CDD:420091 |
| Functional Category | Others |
| Uniprot ID | Q8CUT7 |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1062280 | 1062432 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 2 | 326881 | 327033 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 3 | 684679 | 684831 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 4 | 276582 | 276734 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 5 | 2037687 | 2037839 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 6 | 1237282 | 1237434 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 7 | 3659855 | 3660007 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 8 | 2409552 | 2409704 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 9 | 2437173 | 2437316 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 10 | 4627710 | 4627853 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 11 | 1409371 | 1409496 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 12 | 2188961 | 2189098 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 13 | 3735215 | 3735352 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
++ More..