Protein name |
Small, acid-soluble spore protein P (SASP P) |
NCBI Accession ID |
BA000028.3 |
Organism |
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
Left |
1062280 |
Right |
1062432 |
Strand |
+ |
Nucleotide Sequence |
ATGTCAAAAAGAAAGATGGGGCCAAAACAACAAAAAAATCCAGAACTGCCAAAAAGTCCCGAACAACCATATGGTGAACCATTAAGCGGATCAAAAAAAGAAAAAAAGGCAAATCATTCAGGACAAAAACATAATCCACACCATGGTTTATAA |
Sequence |
MSKRKMGPKQQKNPELPKSPEQPYGEPLSGSKKEKKANHSGQKHNPHHGL |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of cl23918. Profile Description: Small acid-soluble spore protein P family. This family consists of the small acid-soluble spore proteins (SASP) P type (sspP). sspP is expressed only in the forespore compartment of the sporulating cell. sspP is also expressed under sigma-G control from the same promoter as sspO. Mutations deleting sspP causes no discernible effect on sporulation, spore properties or spore germination. |
Pubmed ID |
12235376
|
Domain |
CDD:420091 |
Functional Category |
Others |
Uniprot ID |
Q8CUT7
|
ORF Length (Amino Acid) |
50 |