Result : Q8CRV4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0435 protein SE_1565 |
| NCBI Accession ID | AE015929.1 |
| Organism | Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) |
| Left | 1619271 |
| Right | 1619486 |
| Strand | - |
| Nucleotide Sequence | ATGTCATTATCTAATGAAGAAATGATTTCTAATATAAGACAAAAATTAAATATTGTAAATCAAGCATTACTTAATCCGGAAAAATTTAAATCAACACCTCATCAAGACATAAGCGAAATATATGAATTCGTAATGTCTAAAGATTCATTCTCGCCTAGTGAGGTTACGGCTATTGCTGACCATTTAGGACAGCTTAGACAAGATATGGAGGATTAA |
| Sequence | MSLSNEEMISNIRQKLNIVNQALLNPEKFKSTPHQDISEIYEFVMSKDSFSPSEVTAIADHLGQLRQDMED |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23968. Profile Description: Protein of unknown function (DUF1128). This family consists of several short, hypothetical bacterial proteins of unknown function. |
| Pubmed ID | 12950922 |
| Domain | CDD:420123 |
| Functional Category | Others |
| Uniprot ID | Q8CRV4 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1000607 | 1000822 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 2 | 1059266 | 1059472 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 3 | 1188323 | 1188529 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 4 | 2322233 | 2322439 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 5 | 966931 | 967134 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 6 | 1535558 | 1535743 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 7 | 1732661 | 1732867 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 8 | 461667 | 461870 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 1888073 | 1888279 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 10 | 2519982 | 2520188 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 11 | 184633 | 184836 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 12 | 842132 | 842335 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 13 | 1970603 | 1970803 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 14 | 1970258 | 1970464 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 15 | 803144 | 803326 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 16 | 1036674 | 1036877 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 17 | 1741601 | 1741783 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 18 | 1930464 | 1930670 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 19 | 996586 | 996789 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 20 | 971600 | 971782 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 21 | 1165352 | 1165558 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 22 | 1533792 | 1534001 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 23 | 1994965 | 1995159 | + | NZ_CP012502.1 | Bacillus beveridgei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035288.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07730.15 | 0.74 | 17 | 3122 | same-strand | Histidine kinase |
| 2 | PF02518.28 | 0.74 | 17 | 3122 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 3 | PF00072.26 | 0.96 | 22 | 2545.0 | same-strand | Response regulator receiver domain |
| 4 | PF00196.21 | 0.96 | 22 | 2545.0 | same-strand | Bacterial regulatory proteins, luxR family |
| 5 | PF08281.14 | 0.96 | 22 | 2545.0 | same-strand | Sigma-70, region 4 |
| 6 | PF03631.17 | 0.96 | 22 | 1153.5 | opposite-strand | Virulence factor BrkB |
| 7 | PF01451.23 | 0.96 | 22 | 141.5 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
| 8 | PF02073.17 | 0.96 | 22 | 13.5 | same-strand | Thermophilic metalloprotease (M29) |
| 9 | PF03061.24 | 0.96 | 22 | 1326.0 | same-strand | Thioesterase superfamily |
| 10 | PF08756.12 | 0.91 | 21 | 2015 | opposite-strand | YfkB-like domain |
| 11 | PF04055.23 | 0.78 | 18 | 2051.0 | opposite-strand | Radical SAM superfamily |
| 12 | PF13394.8 | 0.91 | 21 | 2015 | opposite-strand | 4Fe-4S single cluster domain |
| 13 | PF01965.26 | 0.83 | 19 | 3691 | same-strand | DJ-1/PfpI family |
++ More..