Result : A0LI66
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000478.1 |
| Organism | Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) |
| Left | 1766941 |
| Right | 1767234 |
| Strand | - |
| Nucleotide Sequence | ATGGATAAACGGCGCGCCCACGTGTGGATATCGGGGCGGGTGCATGGTGTGGCCTTCCGTGCCTATACGCAAGAGGCGGCCTACCACCTGGGCATCGGCGGATGGGTCAGAAACCTCCCGGACGGCAGGGTCGAAGCCGTATTCGAGGGGGATGCCGACAAGGTCGCACGGATGGTCGAATGGTGCCGGAAAGGCAGTCCCATGAGTCGCGTGACCGAAGTGGAAGTGAGGGAGGAAGATTTCCGGGGAGAATTTGTCCGATTCGAAATAACCTTTGGAAGATGGGGGGCCTGA |
| Sequence | MDKRRAHVWISGRVHGVAFRAYTQEAAYHLGIGGWVRNLPDGRVEAVFEGDADKVARMVEWCRKGSPMSRVTEVEVREEDFRGEFVRFEITFGRWGA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A0LI66 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 134
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1766941 | 1767234 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 2 | 1956989 | 1957225 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 3 | 591286 | 591564 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 4 | 331905 | 332180 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 5 | 301217 | 301474 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 6 | 1717367 | 1717639 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 7 | 1092855 | 1093133 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 8 | 1569939 | 1570211 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 9 | 523638 | 523877 | + | NC_014658.1 | Methanothermus fervidus DSM 2088 |
| 10 | 2661318 | 2661596 | - | NZ_CP007174.1 | Candidatus Nitrososphaera evergladensis SR1 |
| 11 | 1979051 | 1979326 | + | NZ_CP007536.1 | Nitrososphaera viennensis EN76 |
| 12 | 990806 | 991078 | + | NC_008698.1 | Thermofilum pendens Hrk 5 |
| 13 | 93966 | 94247 | + | NZ_CP007493.1 | Thermofilum adornatus 1505 |
| 14 | 4380547 | 4380825 | - | NZ_CP061800.1 | Desulfonema magnum |
| 15 | 753437 | 753682 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 16 | 373976 | 374254 | - | NC_019792.1 | Natronobacterium gregoryi SP2 |
| 17 | 260265 | 260540 | - | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
| 18 | 893046 | 893285 | - | NZ_CP009961.1 | Infirmifilum uzonense |
| 19 | 1374256 | 1374513 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 20 | 6198556 | 6198795 | - | NZ_CP061799.1 | Desulfonema limicola |
| 21 | 1792169 | 1792408 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 22 | 316119 | 316397 | + | NZ_CP058334.1 | Natronomonas halophila |
| 23 | 800190 | 800468 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 24 | 413589 | 413867 | - | NZ_CP071463.1 | Haloterrigena longa |
| 25 | 2765194 | 2765442 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 26 | 1501642 | 1501881 | - | NZ_LT981265.1 | Candidatus Nitrosocaldus cavascurensis |
| 27 | 212486 | 212725 | + | NZ_CP024014.1 | Candidatus Nitrosocaldus islandicus |
| 28 | 662594 | 662872 | + | NC_021921.1 | Halorhabdus tiamatea SARL4B |
| 29 | 3212288 | 3212566 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 30 | 2030323 | 2030571 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 31 | 2309920 | 2310174 | - | NC_013202.1 | Halomicrobium mukohataei DSM 12286 |
| 32 | 453127 | 453366 | - | NZ_CP062310.1 | Infirmifilum lucidum |
| 33 | 1566786 | 1567025 | + | NZ_CP062310.1 | Infirmifilum lucidum |
| 34 | 1299272 | 1299556 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 35 | 1003448 | 1003726 | - | NZ_CP040637.1 | Natrinema pallidum |
| 36 | 691007 | 691255 | + | NZ_CP016804.1 | Halodesulfurarchaeum formicicum |
| 37 | 1481530 | 1481787 | + | NZ_CP024047.1 | Natrarchaeobaculum sulfurireducens |
| 38 | 1297338 | 1297622 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 39 | 598524 | 598775 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 40 | 3390389 | 3390637 | - | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 41 | 5275916 | 5276194 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 42 | 52866 | 53105 | + | NZ_AP018732.1 | Conexivisphaera calida |
| 43 | 2815366 | 2815602 | + | NZ_AP017558.1 | Halopenitus persicus |
| 44 | 1279029 | 1279313 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 45 | 1729971 | 1730225 | - | NZ_CP026309.1 | Salinigranum rubrum |
| 46 | 2068781 | 2069065 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 47 | 2514402 | 2514680 | + | NC_013743.1 | Haloterrigena turkmenica DSM 5511 |
| 48 | 2301379 | 2301657 | + | NZ_CP031305.1 | Natronorubrum bangense |
| 49 | 2356108 | 2356347 | + | NC_018227.2 | Methanoculleus bourgensis MS2 |
| 50 | 1716345 | 1716620 | + | NC_015948.1 | Haloarcula hispanica ATCC 33960 |
| 51 | 2444210 | 2444488 | - | NZ_CP034145.1 | Haloplanus aerogenes |
| 52 | 1087210 | 1087458 | + | NZ_CP082286.1 | Halobaculum roseum |
| 53 | 1143092 | 1143328 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 54 | 2148289 | 2148543 | + | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 55 | 1043297 | 1043572 | + | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 56 | 651203 | 651499 | + | NC_015315.1 | Thermoproteus uzoniensis 768-20 |
| 57 | 955028 | 955306 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 58 | 1570245 | 1570499 | + | NZ_CP058529.1 | Halobaculum halophilum |
| 59 | 296279 | 296533 | + | NZ_CP058335.1 | Natronomonas salina |
| 60 | 892244 | 892519 | + | NZ_CP015520.1 | Thermococcus piezophilus |
| 61 | 1756618 | 1756854 | - | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 62 | 887473 | 887748 | - | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 63 | 2794353 | 2794637 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 64 | 515305 | 515541 | - | NC_013922.1 | Natrialba magadii ATCC 43099 |
| 65 | 2190697 | 2190951 | + | NC_019964.1 | Halovivax ruber XH-70 |
| 66 | 270758 | 271033 | + | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 67 | 224323 | 224610 | + | NC_010525.1 | Pyrobaculum neutrophilum V24Sta |
| 68 | 106467 | 106745 | - | NZ_CP045488.1 | Natronorubrum aibiense |
| 69 | 2811982 | 2812236 | - | NZ_CP031150.1 | Haloplanus rubicundus |
| 70 | 1177737 | 1178015 | + | NC_019962.1 | Natrinema pellirubrum DSM 15624 |
| 71 | 1008960 | 1009202 | + | NC_000854.2 | Aeropyrum pernix K1 |
| 72 | 293690 | 293965 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 73 | 2084495 | 2084773 | - | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 74 | 296427 | 296666 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 75 | 5776969 | 5777271 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 76 | 547332 | 547577 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 77 | 3018162 | 3018449 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 78 | 205696 | 205932 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 79 | 2167128 | 2167415 | + | NC_016645.1 | Pyrobaculum ferrireducens |
| 80 | 979627 | 979902 | - | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 81 | 330048 | 330323 | - | NC_012804.1 | Thermococcus gammatolerans EJ3 |
| 82 | 1428967 | 1429242 | - | NZ_CP006965.1 | Thermococcus paralvinellae |
| 83 | 1329007 | 1329285 | + | NC_019974.1 | Natronococcus occultus SP4 |
| 84 | 1809538 | 1809816 | - | NC_007426.1 | Natronomonas pharaonis DSM 2160 |
| 85 | 2511072 | 2511311 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 86 | 1451277 | 1451531 | + | NZ_LN831302.1 | Halobacterium hubeiense |
| 87 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 88 | 263125 | 263412 | - | NC_009376.1 | Pyrobaculum arsenaticum DSM 13514 |
| 89 | 142527 | 142802 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 90 | 276885 | 277160 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 91 | 1210855 | 1211130 | + | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 92 | 1691148 | 1691396 | - | NZ_CP058579.1 | Halobaculum salinum |
| 93 | 1363330 | 1363605 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 94 | 1643552 | 1643818 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 95 | 822060 | 822311 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 96 | 174596 | 174871 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 97 | 291851 | 292126 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 98 | 2073669 | 2073947 | + | NC_015666.1 | Halopiger xanaduensis SH-6 |
| 99 | 1432168 | 1432404 | + | NC_012029.1 | Halorubrum lacusprofundi ATCC 49239 |
| 100 | 1520142 | 1520417 | - | NZ_CP015101.1 | Thermococcus barossii |
| 101 | 3069271 | 3069537 | - | NZ_CP034345.1 | Haloplanus rallus |
| 102 | 35510 | 35785 | + | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 103 | 3891792 | 3892052 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 104 | 1355154 | 1355429 | + | NZ_CP014855.1 | Thermococcus gorgonarius |
| 105 | 6477769 | 6478020 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 106 | 1825590 | 1825865 | - | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 107 | 1130966 | 1131211 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 108 | 1813627 | 1813902 | - | NZ_LR881183.1 | Thermococcus camini |
| 109 | 2190657 | 2190932 | - | NZ_CP040846.1 | Thermococcus indicus |
| 110 | 1216508 | 1216783 | + | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 111 | 4887876 | 4888124 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 112 | 1672254 | 1672547 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 113 | 2026748 | 2027002 | + | NZ_CP058910.1 | Halosimplex rubrum |
| 114 | 1234749 | 1235000 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 115 | 1191770 | 1192045 | + | NC_018015.1 | Thermococcus cleftensis |
| 116 | 1953996 | 1954244 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 117 | 1553947 | 1554201 | - | NZ_CP011564.1 | Halanaeroarchaeum sulfurireducens |
| 118 | 1681127 | 1681402 | + | NZ_CP019154.1 | Haloarcula taiwanensis |
| 119 | 1960952 | 1961227 | + | NZ_CP014862.1 | Thermococcus profundus |
| 120 | 7676007 | 7676249 | + | NZ_CP023691.1 | Streptomyces platensis |
| 121 | 1319368 | 1319643 | - | NC_014804.1 | Thermococcus barophilus MP |
| 122 | 3016531 | 3016785 | - | NZ_CP058909.1 | Halosimplex pelagicum |
| 123 | 1383091 | 1383366 | - | NZ_CP015106.1 | Thermococcus radiotolerans |
| 124 | 928066 | 928359 | - | NC_016070.1 | Thermoproteus tenax Kra 1 |
| 125 | 1005266 | 1005502 | - | NZ_CP035495.1 | Xylanimonas allomyrinae |
| 126 | 4244456 | 4244692 | - | NZ_CP059164.1 | Nocardioides ungokensis |
| 127 | 2617889 | 2618167 | - | NZ_CP019285.1 | Halobiforma lacisalsi AJ5 |
| 128 | 3357232 | 3357510 | - | NZ_CP069188.1 | Haloterrigena salifodinae |
| 129 | 4130167 | 4130409 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 130 | 1059461 | 1059736 | + | NC_012883.1 | Thermococcus sibiricus MM 739 |
| 131 | 1173076 | 1173363 | - | NC_008701.1 | Pyrobaculum islandicum DSM 4184 |
| 132 | 2625553 | 2625825 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 133 | 1711990 | 1712265 | - | NZ_CP007264.1 | Thermococcus nautili |
| 134 | 235812 | 236087 | - | NZ_CP015102.1 | Thermococcus pacificus |
| 135 | 301821 | 302096 | - | NZ_CP015103.1 | Thermococcus siculi |
++ More..