| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin MazE |
| NCBI Accession ID | AE015929.1 |
| Organism | Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) |
| Left | 1731138 |
| Right | 1731308 |
| Strand | - |
| Nucleotide Sequence | ATGTTATCTTTTAATCAAAATAGAAACCACAGTCTTGAACAATCTTTAAAAGAAGGTTATGCACAAATGGCCGATTTAAACCTCTCCCTAGCAACAGAAGCTTTCCCGATAGAGTGTGAAGCTTGTGATTGCAATGAATCACATTTAATATCTAATTCAAAGAATGAATGA |
| Sequence | MLSFNQNRNHSLEQSLKEGYAQMADLNLSLATEAFPIECEACDCNESHLISNSKNE |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Labile antitoxin that binds to cognate MazF toxin and counteracts its endoribonuclease activity. {ECO:0000250|UniProtKB:P0C7B4}. |
| Pubmed ID | 12950922 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q8CRQ0 |
| ORF Length (Amino Acid) | 56 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 889008 | 889178 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 2 | 925998 | 926168 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 3 | 1297550 | 1297720 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 4 | 848438 | 848608 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 5 | 581239 | 581409 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 2399960 | 2400130 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 7 | 1635863 | 1636033 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 8 | 2012379 | 2012549 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 9 | 77785 | 77955 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 10 | 2090561 | 2090731 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 11 | 2135298 | 2135468 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 12 | 1644955 | 1645125 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 13 | 897932 | 898102 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 14 | 1045238 | 1045405 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 15 | 2041176 | 2041343 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 16 | 471548 | 471718 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 17 | 1815599 | 1815769 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 18 | 80038 | 80208 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 19 | 913714 | 913887 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 20 | 1634197 | 1634367 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 21 | 840211 | 840381 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 22 | 1844773 | 1844943 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 23 | 867818 | 867988 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 24 | 737885 | 738055 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 25 | 1585519 | 1585689 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 26 | 6757 | 6927 | - | NZ_CP027770.1 | Staphylococcus felis |
| 27 | 596185 | 596352 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 28 | 1552221 | 1552388 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 29 | 680745 | 680912 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03703.16 | 1.0 | 29 | 2186 | same-strand | Bacterial PH domain |
| 2 | PF01648.22 | 0.93 | 27 | 1299 | same-strand | 4'-phosphopantetheinyl transferase superfamily |
| 3 | PF17837.3 | 1.0 | 29 | 1299 | same-strand | 4'-phosphopantetheinyl transferase N-terminal domain |
| 4 | PF01168.22 | 1.0 | 29 | 87 | same-strand | Alanine racemase, N-terminal domain |
| 5 | PF00842.23 | 1.0 | 29 | 87 | same-strand | Alanine racemase, C-terminal domain |
| 6 | PF02452.19 | 1.0 | 29 | -3 | same-strand | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
| 7 | PF07228.14 | 1.0 | 29 | 684 | same-strand | Stage II sporulation protein E (SpoIIE) |
| 8 | PF08673.12 | 1.0 | 29 | 684 | same-strand | Phosphoserine phosphatase RsbU, N-terminal domain |
| 9 | PF01740.23 | 0.97 | 28 | 1778.0 | same-strand | STAS domain |
| 10 | PF13466.8 | 0.97 | 28 | 1778.0 | same-strand | STAS domain |
| 11 | PF13581.8 | 1.0 | 29 | 2104 | same-strand | Histidine kinase-like ATPase domain |
| 12 | PF02518.28 | 0.97 | 28 | 2106.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 13 | PF04539.18 | 0.9 | 26 | 2557.0 | same-strand | Sigma-70 region 3 |
| 14 | PF04545.18 | 0.9 | 26 | 2557.0 | same-strand | Sigma-70, region 4 |
| 15 | PF04542.16 | 0.9 | 26 | 2557.0 | same-strand | Sigma-70 region 2 |
| 16 | PF08281.14 | 0.83 | 24 | 2557.0 | same-strand | Sigma-70, region 4 |