Result : Q8CN01
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Copper chaperone CopZ |
| NCBI Accession ID | AE015929.1 |
| Organism | Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) |
| Left | 2165292 |
| Right | 2165498 |
| Strand | + |
| Nucleotide Sequence | ATGACACAAAAAATCATAAAAGTTGAAGGAATGAGTTGCGAACATTGTAGAAACGCCGTAGAATCGGCACTAGCTAAACTAAATGGCGTATCAAGTGCTGAAGTAAATTTAGATGAAAATCATGTACGCGTTGAGTATAATGATTCAAAAGTTACATTTGAAAATATGAAAGAAGCAATTGAAGAACAAGGTTATGATGTTAAATAA |
| Sequence | MTQKIIKVEGMSCEHCRNAVESALAKLNGVSSAEVNLDENHVRVEYNDSKVTFENMKEAIEEQGYDVK |
| Source of smORF | Swiss-Prot |
| Function | Chaperone that serves for the intracellular sequestration and transport of Cu(+). Delivers Cu(+) to the copper-exporting P-type ATPase A (CopA) (By similarity). {ECO:0000250}. |
| Pubmed ID | 12950922 |
| Domain | CDD:412222 |
| Functional Category | Metal-binding |
| Uniprot ID | Q8CN01 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 99
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 455205 | 455411 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 2 | 502043 | 502249 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 3 | 2094680 | 2094886 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 4 | 1749990 | 1750196 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 1110220 | 1110426 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 465871 | 466077 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 7 | 369566 | 369772 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 8 | 1880142 | 1880318 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 9 | 2348405 | 2348611 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 10 | 2333366 | 2333572 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 11 | 1212154 | 1212363 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 12 | 1406767 | 1406976 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 13 | 387071 | 387277 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 14 | 2472620 | 2472826 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 15 | 36769 | 36978 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 16 | 2608736 | 2608942 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 17 | 2647869 | 2648075 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 18 | 2061685 | 2061897 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 19 | 333231 | 333437 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 20 | 1497868 | 1498047 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 21 | 492353 | 492559 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 22 | 688339 | 688545 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 23 | 2493703 | 2493882 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 24 | 2501743 | 2501952 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 25 | 2293092 | 2293301 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 26 | 2366689 | 2366898 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 27 | 2581379 | 2581588 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 28 | 3245802 | 3245984 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 29 | 404729 | 404941 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 30 | 87112 | 87291 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 31 | 3071334 | 3071540 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 32 | 1604399 | 1604605 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 33 | 96599 | 96775 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 34 | 1568267 | 1568446 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 35 | 21227 | 21436 | + | NZ_CP033731.1 | Staphylococcus hominis |
| 36 | 1594725 | 1594931 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 37 | 1854060 | 1854236 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 38 | 3057037 | 3057243 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 39 | 925520 | 925696 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 40 | 53200 | 53376 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 41 | 398292 | 398468 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 42 | 3516226 | 3516405 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 43 | 1636369 | 1636575 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 44 | 2765802 | 2765978 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 45 | 2196472 | 2196678 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 46 | 2918357 | 2918563 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 47 | 2460896 | 2461072 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 48 | 3543903 | 3544109 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 49 | 272364 | 272570 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 50 | 699990 | 700196 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 51 | 1863046 | 1863252 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 52 | 2464569 | 2464775 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 53 | 2428926 | 2429132 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 54 | 1671785 | 1671958 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 55 | 1462724 | 1462900 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 56 | 211876 | 212082 | + | NZ_LS483476.1 | Lederbergia lentus |
| 57 | 2774828 | 2775004 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 58 | 1636402 | 1636575 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 59 | 2533235 | 2533441 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 60 | 2166391 | 2166567 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 61 | 2060469 | 2060645 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 62 | 2301075 | 2301284 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 63 | 1826824 | 1826997 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 64 | 13738 | 13941 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 65 | 3401243 | 3401452 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 66 | 3629563 | 3629772 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 67 | 3796309 | 3796500 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 68 | 1850075 | 1850251 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 69 | 370332 | 370508 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 70 | 2646564 | 2646767 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 71 | 3524546 | 3524746 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 72 | 4093361 | 4093567 | - | NZ_CP053989.1 | Niallia circulans |
| 73 | 2214618 | 2214797 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 74 | 482226 | 482426 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 75 | 2024161 | 2024367 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 76 | 795793 | 795999 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 77 | 577792 | 577968 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 78 | 1544409 | 1544585 | + | NZ_CP012024.1 | Bacillus smithii |
| 79 | 1654795 | 1654968 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 80 | 2356428 | 2356601 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 81 | 4794895 | 4795086 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 82 | 546392 | 546592 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 83 | 86512 | 86718 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 84 | 1307333 | 1307512 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 85 | 670098 | 670301 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 86 | 2769180 | 2769380 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 87 | 5143802 | 5144002 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 88 | 2116642 | 2116842 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 89 | 394004 | 394180 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 90 | 2324140 | 2324310 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 91 | 1651620 | 1651820 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 92 | 3973666 | 3973869 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 93 | 3329250 | 3329429 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 94 | 1191572 | 1191778 | - | NZ_CP009501.1 | Methanosarcina thermophila TM-1 |
| 95 | 735379 | 735552 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 96 | 1745305 | 1745481 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 97 | 132335 | 132535 | - | NZ_CP026363.1 | Brevibacillus agri |
| 98 | 331771 | 331962 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 99 | 3156773 | 3156946 | - | NZ_CP033433.1 | Cohnella candidum |
| 100 | 619639 | 619812 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 101 | 2648811 | 2649017 | + | NZ_CP032683.1 | Methanosarcina flavescens |
| 102 | 1476044 | 1476214 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 103 | 1645940 | 1646146 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 104 | 2124129 | 2124332 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 105 | 7035014 | 7035184 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 106 | 673962 | 674174 | + | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 107 | 619505 | 619705 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 108 | 1940663 | 1940836 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 109 | 1175141 | 1175317 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 110 | 1735626 | 1735802 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035288.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00122.22 | 0.88 | 87 | 69 | same-strand | E1-E2 ATPase |
| 2 | PF00702.28 | 0.87 | 86 | 70.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 3 | PF00403.28 | 0.88 | 87 | 69 | same-strand | Heavy-metal-associated domain |
++ More..