Result : Q8ABV5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S17 2 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 3460 |
| Right | 3996 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAATGGTATTGAAGAAATATTGAAAGAACATGAGGCACTGTGCAGCCGGGTATTTCATCTTCTGAATACAGGTAATCCGCAAACTAAGGATATAGAACTTATCATACCTAAAGTGAAAGAACTGTTCGGAATGCTGGAAGCCGTCAATACCAAACAAATCACTGCACAGCAATATAACGGCTTGCTGAATGTGATGAGTGAATGGAACGCTATTTTCAGCTATTTCAATATTAAGATGGTGCCGTGCCGTTTACGGCCTTTCTTATGGAACTCTCCAAAGGTAGCTGTAAAAAGAATACCCCGGCAATGTATCGAGGGGATAGTGGTAAGCACGAAAATGCAAAAGACGGTTGTCATAGAGGTGGAACGTACGAAAAAGCATCCGAAGTATGGGAAAACAGTACAATATACGAAAAAGTATAAAATACATGATCCCCTGGAGGAATGTAGTGTAGGAGACCGGGTGCTTGCTCATGAAACCAGACATTTCAGCAAGACTAAATATTTTAGATTTTACAGAAAACTGTATTGA |
| Sequence | MVPCRLRPFLWNSPKVAVKRIPRQCIEGIVVSTKMQKTVVIEVERTKKHPKYGKTVQYTKKYKIHDPLEECSVGDRVLAHETRHFSKTKYFRFYRKLY |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_01345}. |
| Pubmed ID | 12663928 |
| Domain | CDD:412327 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8ABV5 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3581798 | 3582094 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 7660324 | 7660611 | - | NC_014666.1 | Frankia inefficax |
| 3 | 964503 | 964769 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 4 | 1325796 | 1326056 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 5 | 4907283 | 4907567 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 6 | 3897478 | 3897759 | - | NZ_CP059164.1 | Nocardioides ungokensis |
| 7 | 1242821 | 1243081 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 8 | 1127924 | 1128193 | - | NZ_CP014635.1 | Corynebacterium simulans |
| 9 | 1665268 | 1665558 | + | NZ_CP041694.1 | Cellulosimicrobium cellulans |
| 10 | 151492 | 151755 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 11 | 1722638 | 1722910 | - | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 12 | 5774487 | 5774756 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 13 | 1212761 | 1213021 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 14 | 1042133 | 1042393 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 15 | 1809773 | 1810033 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 16 | 1149500 | 1149760 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 17 | 1816044 | 1816304 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 18 | 1664954 | 1665199 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 19 | 2129969 | 2130229 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 20 | 1008854 | 1009114 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 21 | 2400566 | 2400826 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 22 | 1550997 | 1551257 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 23 | 978225 | 978485 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 24 | 6715352 | 6715606 | + | NZ_CP032869.1 | Mucilaginibacter celer |
| 25 | 1123774 | 1124028 | - | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 26 | 60699 | 60959 | + | NZ_CP036259.1 | Sporomusa termitida |
| 27 | 9177947 | 9178219 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 28 | 586289 | 586561 | + | NZ_AP018676.1 | Helicobacter cinaedi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014666.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00410.21 | 0.89 | 25 | 1576 | same-strand | Ribosomal protein S8 |
| 2 | PF00253.23 | 0.86 | 24 | 1361.0 | same-strand | Ribosomal protein S14p/S29e |
| 3 | PF00673.23 | 0.89 | 25 | 794 | same-strand | ribosomal L5P family C-terminus |
| 4 | PF00281.21 | 0.89 | 25 | 794 | same-strand | Ribosomal protein L5 |
| 5 | PF17136.6 | 0.86 | 24 | 432.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 6 | PF00467.31 | 0.86 | 24 | 432.0 | same-strand | KOW motif |
| 7 | PF00238.21 | 0.89 | 25 | 43 | same-strand | Ribosomal protein L14p/L23e |
| 8 | PF00831.25 | 0.96 | 27 | 21 | same-strand | Ribosomal L29 protein |
| 9 | PF00252.20 | 0.96 | 27 | 234 | same-strand | Ribosomal protein L16p/L10e |
| 10 | PF00189.22 | 0.96 | 27 | 674 | same-strand | Ribosomal protein S3, C-terminal domain |
| 11 | PF07650.19 | 0.96 | 27 | 674 | same-strand | KH domain |
| 12 | PF00237.21 | 0.96 | 27 | 1368 | same-strand | Ribosomal protein L22p/L17e |
| 13 | PF00203.23 | 0.96 | 27 | 1790 | same-strand | Ribosomal protein S19 |
++ More..