Result : A9BJC5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | CP000879.1 |
| Organism | Petrotoga mobilis (strain DSM 10674 / SJ95) |
| Left | 657364 |
| Right | 657633 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAGCTTGTTCTCAAGTCTATTGATTTTTATAGAAAACATATATCGCCTGCAACTCCTCCCAAATGTATCTACCTACCGACCTGCTCATCTTACACCTATGAAGCGGTGGAAAAGTTCGGGGTATTTAAAGGTTTGTACTTGGGATTTAGACGTTTTATCAGATGCAATCCATTACACAAAGGGGGCTACGATCCTGTCCCTGAAAAGTTTTCTTTTTTTGTTCATAAGCAAGGAAAAAATAAACAACACAGAAGGAGTGTATGA |
| Sequence | MKKLVLKSIDFYRKHISPATPPKCIYLPTCSSYTYEAVEKFGVFKGLYLGFRRFIRCNPLHKGGYDPVPEKFSFFVHKQGKNKQHRRSV |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | A9BJC5 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 74
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 657364 | 657633 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 2 | 681584 | 681847 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 3 | 1327973 | 1328245 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 4 | 1832337 | 1832582 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 5 | 1618902 | 1619147 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 6 | 818894 | 819157 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 7 | 284287 | 284529 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 8 | 188668 | 188937 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 9 | 1298490 | 1298786 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 10 | 1135974 | 1136231 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 11 | 210981 | 211226 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 12 | 1325138 | 1325383 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 13 | 1339337 | 1339582 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 14 | 242260 | 242502 | + | NZ_LS974202.1 | Mesotoga infera |
| 15 | 1348763 | 1349008 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 16 | 808716 | 808955 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 17 | 801881 | 802120 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 18 | 1962511 | 1962750 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 19 | 2044175 | 2044453 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 20 | 640366 | 640605 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 21 | 845283 | 845525 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 22 | 930657 | 930932 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 23 | 1022695 | 1022934 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 24 | 1123429 | 1123677 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 25 | 1392710 | 1392940 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 26 | 1577131 | 1577370 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 27 | 3008160 | 3008405 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 28 | 2032661 | 2032897 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 29 | 1044934 | 1045167 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 30 | 319909 | 320142 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 31 | 1608814 | 1609065 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 32 | 1870308 | 1870544 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 33 | 1922756 | 1923004 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 34 | 820598 | 820858 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 35 | 3912459 | 3912716 | + | NZ_CP053989.1 | Niallia circulans |
| 36 | 308693 | 308953 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 37 | 1380993 | 1381247 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 38 | 1271671 | 1271913 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 39 | 2294698 | 2294937 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 40 | 2618145 | 2618387 | + | NZ_CP012024.1 | Bacillus smithii |
| 41 | 254888 | 255163 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 42 | 1073968 | 1074198 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 43 | 1465334 | 1465576 | - | NZ_LS483343.1 | Streptococcus ferus |
| 44 | 3573994 | 3574227 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 45 | 1155733 | 1155966 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 46 | 2307163 | 2307435 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 47 | 1005380 | 1005619 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 48 | 2871692 | 2871925 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 49 | 2362118 | 2362357 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 50 | 1597696 | 1597917 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 51 | 1327810 | 1328076 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 52 | 1442998 | 1443252 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 53 | 5849766 | 5849999 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 54 | 1796316 | 1796582 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 55 | 1167117 | 1167347 | - | NZ_CP016540.2 | Planococcus versutus |
| 56 | 971148 | 971378 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 57 | 1383465 | 1383719 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 58 | 1202009 | 1202239 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 59 | 1252680 | 1252910 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 60 | 1158242 | 1158475 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 61 | 1217110 | 1217340 | - | NZ_CP016538.2 | Planococcus maritimus |
| 62 | 1227661 | 1227891 | - | NZ_CP059540.1 | Planococcus maritimus |
| 63 | 1160565 | 1160801 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 64 | 3118787 | 3119008 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 65 | 542783 | 543013 | + | NZ_CP013661.2 | Planococcus kocurii |
| 66 | 1227800 | 1228030 | - | NZ_CP019401.1 | Planococcus faecalis |
| 67 | 1637934 | 1638170 | + | NZ_CP023049.2 | Chryseobacterium piperi |
| 68 | 1276783 | 1277043 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 69 | 1196497 | 1196739 | + | NZ_CP043405.1 | Streptococcus ratti |
| 70 | 1483225 | 1483500 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 71 | 1299538 | 1299768 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 72 | 5347258 | 5347530 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 73 | 13304 | 13558 | + | NZ_CP013237.1 | Streptococcus mutans |
| 74 | 3571935 | 3572156 | + | NZ_CP047984.1 | Pontibacter russatus |
| 75 | 51541 | 51768 | - | NZ_CP022375.1 | Francisella opportunistica |
++ More..