| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable tautomerase bsl7456 (EC 5.3.2.-) |
| NCBI Accession ID | |
| Organism | Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MPEITVSMAEGRTDEQKAGMMRDITQALVKNLGVDADAVVIQINEAPLRHKMKGGKTFVERAAAAKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
| Pubmed ID | 12597275 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | Q89DI3 |
| ORF Length (Amino Acid) | 67 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 8174909 | 8175112 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 2 | 2093500 | 2093703 | - | NZ_CP044543.1 | Bradyrhizobium betae |
| 3 | 1134695 | 1134898 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 4 | 1643341 | 1643544 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 5 | 6281987 | 6282190 | - | NC_017082.1 | Bradyrhizobium cosmicum |
| 6 | 8128791 | 8128994 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 7 | 860778 | 860981 | + | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 8 | 3750794 | 3750997 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 9 | 693650 | 693853 | + | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 10 | 1454977 | 1455180 | - | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 11 | 8819886 | 8820089 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 12 | 6592563 | 6592766 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 13 | 6280111 | 6280311 | - | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 14 | 6840714 | 6840926 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 15 | 7134721 | 7134921 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 16 | 7013633 | 7013836 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 17 | 1272024 | 1272227 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 18 | 952529 | 952726 | + | NC_015684.1 | Afipia carboxidovorans OM5 |
| 19 | 1998973 | 1999158 | - | NZ_CP044117.1 | Roseomonas mucosa |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00885.21 | 0.79 | 15 | 2856 | same-strand | 6,7-dimethyl-8-ribityllumazine synthase |
| 2 | PF10722.11 | 0.84 | 16 | 1701.0 | opposite-strand | Putative bacterial sensory transduction regulator |
| 3 | PF14748.8 | 0.84 | 16 | 691.0 | opposite-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 4 | PF03807.19 | 0.84 | 16 | 691.0 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
| 5 | PF13393.8 | 0.79 | 15 | 119 | same-strand | Histidyl-tRNA synthetase |
| 6 | PF03129.22 | 0.89 | 17 | 119 | same-strand | Anticodon binding domain |
| 7 | PF01063.21 | 0.84 | 16 | 2407.0 | same-strand | Amino-transferase class IV |
| 8 | PF12802.9 | 0.79 | 15 | 3865 | opposite-strand | MarR family |
| 9 | PF13463.8 | 0.79 | 15 | 3865 | opposite-strand | Winged helix DNA-binding domain |
| 10 | PF01047.24 | 0.79 | 15 | 3865 | opposite-strand | MarR family |
| 11 | PF00072.26 | 0.84 | 16 | 4330.5 | opposite-strand | Response regulator receiver domain |
| 12 | PF00486.30 | 0.79 | 15 | 4347 | opposite-strand | Transcriptional regulatory protein, C terminal |