Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L25 |
NCBI Accession ID | AE016826.1 |
Organism | Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) |
Left | 142440 |
Right | 142733 |
Strand | + |
Nucleotide Sequence | ATGTTAACTATTTATGGAATTAGTCGTACTAAATGTGGTAAAAAAGCTAGTCGCAGATTGCGTTTACAGAATAAATTTCCAGCTATAATTCATGTTTCTTTAATTTCTAATATTTCTATTGAGTTAAGTCAAAATGATTTTATTAATATAGAAATGAAAAATTCTGATTTTTATAAGAGTGAAGTTATTTTAATAGTAGATAAGGTTAAATATATTGTTAAAATACAGGAAATTCAAAGACATGCATTTAAGTCTAAAATATTACATATTGATTTTTTAAAAGTTAGTGTATAA |
Sequence | MLTIYGISRTKCGKKASRRLRLQNKFPAIIHVSLISNISIELSQNDFINIEMKNSDFYKSEVILIVDKVKYIVKIQEIQRHAFKSKILHIDFLKVSV |
Source of smORF | Swiss-Prot |
Function | This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance. {ECO:0000255|HAMAP-Rule:MF_01336}. |
Pubmed ID | 12522265 |
Domain | CDD:412568 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q89AV5 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 142440 | 142733 | + | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
2 | 2847285 | 2847566 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
3 | 1656861 | 1657145 | - | NZ_CP011118.1 | Yersinia enterocolitica |
4 | 852448 | 852729 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
5 | 2685984 | 2686265 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13989.8 | 0.8 | 4 | 4794.0 | opposite-strand | YejG-like protein |
2 | PF07690.18 | 0.8 | 4 | 2946.0 | opposite-strand | Major Facilitator Superfamily |
3 | PF00849.24 | 0.8 | 4 | 2198.5 | opposite-strand | RNA pseudouridylate synthase |
4 | PF01479.27 | 0.8 | 4 | 2198.5 | opposite-strand | S4 domain |
5 | PF04851.17 | 0.8 | 4 | 165.0 | same-strand | Type III restriction enzyme, res subunit |
6 | PF00271.33 | 0.8 | 4 | 165.0 | same-strand | Helicase conserved C-terminal domain |
7 | PF00270.31 | 0.8 | 4 | 165.0 | same-strand | DEAD/DEAH box helicase |
8 | PF04245.15 | 0.8 | 4 | 98.0 | opposite-strand | 37-kD nucleoid-associated bacterial protein |
9 | PF07208.13 | 0.8 | 4 | 1382.0 | same-strand | Protein of unknown function (DUF1414) |
10 | PF11893.10 | 0.8 | 4 | 1638.5 | same-strand | Domain of unknown function (DUF3413) |