ProsmORF-pred
Result : Q89AN0
Protein Information
Information Type Description
Protein name UPF0125 protein bbp_234
NCBI Accession ID AE016826.1
Organism Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Left 272425
Right 272685
Strand -
Nucleotide Sequence ATGATCACAATTACAATTGTATATTTTACAAATAAAATTCAGCATGTTAAAAAAATTAAACTAAACATAGGCACTCCAGTTCATGAAGCTCTAAAAATATTACAAATTAATATAAAAAAAAATAATAAAATTGGAATTTATGGTGAATTAGTATCACTTAATCATATTTTAAATAACAAAGATAGACTTGAAATTTATAGACCGTTAAAAATAAATCCAAGAGAACTGAGAAAACAAAAAATAAATCGTAAACTTAAATAA
Sequence MITITIVYFTNKIQHVKKIKLNIGTPVHEALKILQINIKKNNKIGIYGELVSLNHILNNKDRLEIYRPLKINPRELRKQKINRKLK
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states.
Pubmed ID 12522265
Domain CDD:421700
Functional Category Others
Uniprot ID Q89AN0
ORF Length (Amino Acid) 86
++ More..