Result : Q89AB9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sulfur carrier protein TusA (Sulfur mediator TusA) (Sulfur transfer protein TusA) (tRNA 2-thiouridine synthesizing protein A) |
| NCBI Accession ID | AE016826.1 |
| Organism | Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) |
| Left | 460933 |
| Right | 461172 |
| Strand | + |
| Nucleotide Sequence | ATGACTGTTGACAACAATGTCTTAGACTTAAGAAAATTACGATGTCCTGAACCAATTATGTTATTAAGAAAAAAAATACGAGAAATTAAAAATGGAACCACATTATTAATACTCTCAGATGATCCGTCGACTATAAGAGAAATTCCTCAATATTGTAAGTTTATGCACCATAAGTTATTAAAAATAAACACAAAAGATACAATTTACAAATTTTGGATACAAAAAACTCATAAAATGTAA |
| Sequence | MTVDNNVLDLRKLRCPEPIMLLRKKIREIKNGTTLLILSDDPSTIREIPQYCKFMHHKLLKINTKDTIYKFWIQKTHKM |
| Source of smORF | Swiss-Prot |
| Function | Sulfur carrier protein involved in sulfur trafficking in the cell. Part of a sulfur-relay system required for 2-thiolation during synthesis of 2-thiouridine of the modified wobble base 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) in tRNA. Interacts with IscS and stimulates its cysteine desulfurase activity. Accepts an activated sulfur from IscS, which is then transferred to TusD, and thus determines the direction of sulfur flow from IscS to 2-thiouridine formation. Also appears to be involved in sulfur transfer for the biosynthesis of molybdopterin. {ECO:0000255|HAMAP-Rule:MF_00413}. |
| Pubmed ID | 12522265 |
| Domain | CDD:412376 |
| Functional Category | Others |
| Uniprot ID | Q89AB9 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 460933 | 461172 | + | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
| 2 | 1760474 | 1760713 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 3 | 18906 | 19103 | - | NZ_CP037951.1 | Parashewanella tropica |
| 4 | 572198 | 572437 | - | NZ_LR134167.1 | Avibacterium volantium |
| 5 | 98496 | 98735 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 6 | 1508368 | 1508607 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 7 | 1514268 | 1514507 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 8 | 21683 | 21928 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 9 | 2158836 | 2159084 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 10 | 58902 | 59135 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 11 | 1779258 | 1779455 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 12 | 375084 | 375323 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 13 | 1569638 | 1569877 | + | NZ_CP016604.1 | Otariodibacter oris |
| 14 | 2221501 | 2221743 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 15 | 970894 | 971118 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 16 | 778212 | 778448 | + | NZ_CP007445.1 | Gilliamella apicola |
| 17 | 14828 | 15076 | - | NZ_CP033078.1 | Vibrio zhugei |
| 18 | 240151 | 240399 | + | NZ_LS483470.1 | Leminorella richardii |
| 19 | 1839706 | 1839945 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 20 | 3593249 | 3593503 | - | NZ_LS483422.1 | Providencia heimbachae |
| 21 | 2300881 | 2301126 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 22 | 9393 | 9638 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 23 | 30571 | 30816 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 24 | 18083 | 18280 | - | NZ_CP022272.1 | Shewanella marisflavi |
| 25 | 16177 | 16422 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 26 | 16120 | 16365 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 27 | 15515 | 15760 | - | NZ_CP020472.1 | Shewanella japonica |
| 28 | 453998 | 454252 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 29 | 2711725 | 2711973 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 30 | 24870 | 25115 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 31 | 23748 | 23993 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 32 | 330144 | 330395 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 33 | 2563869 | 2564120 | - | NZ_CP049115.1 | Pantoea stewartii |
| 34 | 24175 | 24375 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 35 | 3740896 | 3741147 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 36 | 334157 | 334408 | + | NZ_CP038853.1 | Pantoea vagans |
| 37 | 2389955 | 2390206 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
| 38 | 2388458 | 2388709 | + | NZ_CP010975.1 | Kangiella geojedonensis |
| 39 | 935786 | 935992 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 40 | 1953483 | 1953722 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 41 | 2008478 | 2008684 | + | NZ_CP046531.1 | Mannheimia ovis |
| 42 | 1913548 | 1913784 | - | NZ_CP009056.1 | Frischella perrara |
| 43 | 512231 | 512449 | - | NZ_CP040990.1 | Vibrio furnissii |
| 44 | 3932066 | 3932320 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 45 | 1641362 | 1641607 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 46 | 2050898 | 2051110 | + | NZ_CP026364.1 | Proteus hauseri |
| 47 | 18184 | 18429 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 48 | 3732397 | 3732603 | - | NZ_CP048796.1 | Providencia vermicola |
| 49 | 982838 | 983086 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 50 | 15106 | 15303 | - | NZ_CP046378.1 | Shewanella algae |
| 51 | 16482 | 16727 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 52 | 3120468 | 3120668 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 53 | 343249 | 343500 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 54 | 20737 | 20982 | - | NZ_CP069213.1 | Shewanella litorisediminis |
| 55 | 3693645 | 3693893 | - | NZ_CP065534.1 | Lonsdalea populi |
| 56 | 13476 | 13676 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 57 | 24362 | 24607 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 58 | 11579 | 11824 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 59 | 19884 | 20129 | - | NC_016901.1 | Shewanella baltica OS678 |
| 60 | 31522 | 31767 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 61 | 3325884 | 3326096 | - | NZ_CP044060.1 | Aeromonas veronii |
| 62 | 3574112 | 3574324 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 63 | 3450899 | 3451111 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 64 | 4429178 | 4429390 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 65 | 141273 | 141485 | - | NZ_CP050851.1 | Aeromonas hydrophila |
++ More..