Result : A9BHX3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000879.1 |
| Organism | Petrotoga mobilis (strain DSM 10674 / SJ95) |
| Left | 1491651 |
| Right | 1491953 |
| Strand | + |
| Nucleotide Sequence | TTGCCAAATAAAAAATCAGCAGAAAAAAGGGTTAGACAATCAGAACAAAGAAGACAAAAAAATCGTGGATATCAAAAGAGGATCAAGGAAATTTCTAAGGAAATAGACAAGAAAATACATGAAAATGCCGAAAGAGAAGAATTGATGCAGTTATTAAGCAAGTCTTTTAAAATTATTGACACTGCGAAATCACATGGTGCTGTACATAAAAACTACGCAGCAAGGAAAAAATCGAAATTACATTTAAAGGTTAAAAAATATTTAGGCGAAATGGCACCAGAAAGTTCACCAGTAAACGAGTGA |
| Sequence | MPNKKSAEKRVRQSEQRRQKNRGYQKRIKEISKEIDKKIHENAEREELMQLLSKSFKIIDTAKSHGAVHKNYAARKKSKLHLKVKKYLGEMAPESSPVNE |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A9BHX3 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1491651 | 1491953 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 2 | 1760231 | 1760548 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 3 | 1568403 | 1568690 | + | NZ_AP018712.1 | Tepiditoga spiralis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010003.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01715.19 | 1.0 | 3 | 2767 | same-strand | IPP transferase |
| 2 | PF17209.5 | 1.0 | 3 | 2501 | same-strand | Hfq protein |
| 3 | PF02773.18 | 1.0 | 3 | 78 | same-strand | S-adenosylmethionine synthetase, C-terminal domain |
| 4 | PF02772.18 | 1.0 | 3 | 78 | same-strand | S-adenosylmethionine synthetase, central domain |
| 5 | PF00438.22 | 1.0 | 3 | 78 | same-strand | S-adenosylmethionine synthetase, N-terminal domain |
| 6 | PF02390.19 | 1.0 | 3 | 61 | same-strand | Putative methyltransferase |
| 7 | PF07479.16 | 1.0 | 3 | 1003 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus |
| 8 | PF01210.25 | 1.0 | 3 | 1003 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus |
| 9 | PF03807.19 | 1.0 | 3 | 1003 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 10 | PF03446.17 | 0.67 | 2 | 1000.5 | same-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
| 11 | PF00730.27 | 0.67 | 2 | 2549.0 | opposite-strand | HhH-GPD superfamily base excision DNA repair protein |
| 12 | PF00633.25 | 0.67 | 2 | 2549.0 | opposite-strand | Helix-hairpin-helix motif |
| 13 | PF10576.11 | 0.67 | 2 | 2549.0 | opposite-strand | Iron-sulfur binding domain of endonuclease III |
| 14 | PF02464.19 | 0.67 | 2 | 3628.0 | same-strand | Competence-damaged protein |
| 15 | PF00994.26 | 0.67 | 2 | 3628.0 | same-strand | Probable molybdopterin binding domain |
++ More..