Result : Q89A44
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable Fe(2+)-trafficking protein |
| NCBI Accession ID | AE016826.1 |
| Organism | Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) |
| Left | 563710 |
| Right | 563973 |
| Strand | + |
| Nucleotide Sequence | ATGAATAAGAAAAATGATATCAATCGAAAAATTTTTTGTAATTTTTTCAAAAAGTACGAAGAAGGTTTAACATATATACCCTATCCAGGATTATTAGGGCATAAAATTTATAATGAAATTTCTAAACTAGCTTGGAACAAATGGATATTACAACAAACAATCATTATCAACGAAAAAAAAATGAATATGCTAAATAAAAATGATCAAAAAAAAATAGAAAATTATATGATCAAATTCTTATTTAAAAATAAACAACAACTTTAA |
| Sequence | MNKKNDINRKIFCNFFKKYEEGLTYIPYPGLLGHKIYNEISKLAWNKWILQQTIIINEKKMNMLNKNDQKKIENYMIKFLFKNKQQL |
| Source of smORF | Swiss-Prot |
| Function | Could be a mediator in iron transactions between iron acquisition and iron-requiring processes, such as synthesis and/or repair of Fe-S clusters in biosynthetic enzymes. {ECO:0000255|HAMAP-Rule:MF_00686}. |
| Pubmed ID | 12522265 |
| Domain | CDD:412743 |
| Functional Category | Others |
| Uniprot ID | Q89A44 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 563710 | 563973 | + | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
| 2 | 1582496 | 1582768 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 3 | 3140408 | 3140680 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 4 | 2062009 | 2062281 | + | NZ_CP049115.1 | Pantoea stewartii |
| 5 | 3543869 | 3544141 | + | NZ_CP061511.1 | Mixta calida |
| 6 | 417560 | 417832 | - | NZ_CP050150.1 | Hafnia alvei |
| 7 | 2900194 | 2900466 | + | NZ_CP028271.1 | Mixta intestinalis |
| 8 | 892214 | 892486 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 9 | 2314180 | 2314452 | - | NZ_CP019706.1 | Pantoea alhagi |
| 10 | 1097487 | 1097759 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 11 | 1116616 | 1116888 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 12 | 3752769 | 3753041 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 13 | 3939550 | 3939822 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 14 | 1182840 | 1183112 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 15 | 4910017 | 4910289 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 16 | 3003138 | 3003410 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 17 | 805799 | 806071 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 18 | 3788400 | 3788672 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 19 | 3324536 | 3324808 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 20 | 767280 | 767552 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 21 | 744542 | 744814 | - | NZ_CP038853.1 | Pantoea vagans |
| 22 | 1877220 | 1877492 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 23 | 236817 | 237089 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 24 | 2024086 | 2024358 | + | NZ_CP009787.1 | Yersinia rohdei |
| 25 | 748220 | 748492 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 26 | 3121142 | 3121414 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 27 | 3727529 | 3727801 | + | NZ_CP026377.1 | Mixta gaviniae |
| 28 | 2024165 | 2024425 | + | NZ_CP009056.1 | Frischella perrara |
| 29 | 4410945 | 4411217 | + | NZ_LT906479.1 | Serratia ficaria |
| 30 | 692967 | 693239 | - | NZ_CP071320.1 | Serratia ureilytica |
| 31 | 3713550 | 3713822 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 32 | 4428167 | 4428439 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 33 | 898268 | 898540 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 34 | 449560 | 449832 | + | NZ_CP007230.1 | Yersinia similis |
| 35 | 975312 | 975581 | - | NZ_CP048796.1 | Providencia vermicola |
| 36 | 4479359 | 4479631 | + | NZ_LR134494.1 | Serratia quinivorans |
| 37 | 592896 | 593168 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 38 | 371702 | 371974 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 39 | 4478474 | 4478746 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 40 | 3178117 | 3178389 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 41 | 238260 | 238532 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 42 | 4542234 | 4542506 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 43 | 3792604 | 3792876 | + | NZ_CP043727.1 | Yersinia canariae |
| 44 | 32244 | 32519 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 45 | 1955235 | 1955507 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 46 | 1083041 | 1083313 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 47 | 928824 | 929096 | - | NZ_CP065534.1 | Lonsdalea populi |
| 48 | 3648844 | 3649116 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 49 | 5277979 | 5278251 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 50 | 3883643 | 3883918 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 51 | 801198 | 801473 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 52 | 4389424 | 4389699 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 53 | 4083413 | 4083688 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 54 | 83123 | 83365 | - | NC_016893.1 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans morsitans (Yale colony) |
| 55 | 3917281 | 3917556 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 56 | 4017140 | 4017415 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 57 | 4196719 | 4196994 | - | NZ_CP038469.1 | Citrobacter tructae |
| 58 | 2159413 | 2159688 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 59 | 3229340 | 3229609 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 60 | 1875704 | 1875973 | + | NZ_CP033744.1 | Citrobacter freundii |
| 61 | 3797492 | 3797767 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 62 | 3597732 | 3598007 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 63 | 3686563 | 3686838 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 64 | 4964566 | 4964838 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 65 | 785383 | 785658 | - | NZ_CP045845.1 | Kluyvera intermedia |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011078.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02390.19 | 0.95 | 62 | 1268.0 | opposite-strand | Putative methyltransferase |
| 2 | PF00730.27 | 1.0 | 65 | 0 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
| 3 | PF14815.8 | 1.0 | 65 | 0 | same-strand | NUDIX domain |
| 4 | PF00633.25 | 0.98 | 64 | 0.0 | same-strand | Helix-hairpin-helix motif |
| 5 | PF11101.10 | 0.89 | 58 | 2436.0 | opposite-strand | Protein of unknown function (DUF2884) |
| 6 | PF04320.16 | 0.91 | 59 | 1988 | opposite-strand | YggL 50S ribosome-binding protein |
| 7 | PF10576.11 | 0.6 | 39 | 3 | same-strand | Iron-sulfur binding domain of endonuclease III |
| 8 | PF11873.10 | 0.98 | 64 | 55.0 | same-strand | Membrane-bound lytic murein transglycosylase C, N-terminal domain |
| 9 | PF01464.22 | 0.98 | 64 | 55.0 | same-strand | Transglycosylase SLT domain |
++ More..