Result : Q88WR7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | AL935263.2 |
| Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
| Left | 1420607 |
| Right | 1420879 |
| Strand | - |
| Nucleotide Sequence | ATGCGTGCAGTAACATTAAAAGCAACCGGCCGGGTCCAGGGGGTGGGCTTCCGTTGGGCCACTAAAGTTGCCGCTGACAAATGCGGCGTGAACGGAATCGTTCGTAACCTGATGGACGGCTCAGTCTTTATTGAAGCCGAGGGTGAAGATCAACGAGTGCAAGTCTTTATCGACGTTGTTCGGCAGTCGCCAACCGATTTTGGCAAGGTCAAGCACCTCGAAGTGCATGAAGTTGAACCACAAAACTATCACGATTTTCGGATAACCAATTGA |
| Sequence | MRAVTLKATGRVQGVGFRWATKVAADKCGVNGIVRNLMDGSVFIEAEGEDQRVQVFIDVVRQSPTDFGKVKHLEVHEVEPQNYHDFRITN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 12566566 22156394 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q88WR7 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1640618 | 1640890 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 2 | 1025109 | 1025381 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 3 | 1771005 | 1771280 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 4 | 1115303 | 1115578 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 5 | 2281611 | 2281883 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 6 | 1410277 | 1410549 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 7 | 864667 | 864942 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 8 | 941320 | 941595 | - | NZ_CP065211.1 | Enterococcus lactis |
| 9 | 1643552 | 1643779 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032757.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.89 | 8 | 108.0 | same-strand | 60Kd inner membrane protein |
| 2 | PF00588.21 | 0.89 | 8 | 148.5 | opposite-strand | SpoU rRNA Methylase family |
| 3 | PF08032.14 | 0.89 | 8 | 148.5 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
++ More..