Result : Q88WD0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable tautomerase lp_1712 (EC 5.3.2.-) |
| NCBI Accession ID | AL935263.2 |
| Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
| Left | 1553081 |
| Right | 1553275 |
| Strand | + |
| Nucleotide Sequence | ATGCCAATCGTACACATTGATCTAATTGCTGGTCGTTCACAAGAACAACTTAAAAACTTGGTGAAAGATGTTACTGACGCGGTCAGCAAGAATACCGGTGCACCAGCAGAACACATTCACGTGATTTTAAGTGAGATGCAGAAAAATCGCTATAGTGTTGGTGGTGTCTTAAAGAGCGACGAAGAAGCAGAATAG |
| Sequence | MPIVHIDLIAGRSQEQLKNLVKDVTDAVSKNTGAPAEHIHVILSEMQKNRYSVGGVLKSDEEAE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
| Pubmed ID | 12566566 22156394 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | Q88WD0 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 145
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1776055 | 1776249 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 2 | 1202624 | 1202818 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 3 | 2873025 | 2873213 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 4 | 1957278 | 1957469 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 5 | 978313 | 978501 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 6 | 1012526 | 1012714 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 7 | 1690048 | 1690236 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 8 | 942200 | 942388 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 9 | 568409 | 568597 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 10 | 879437 | 879625 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 11 | 1893013 | 1893201 | - | NZ_CP018906.1 | Lentilactobacillus curieae |
| 12 | 2040265 | 2040453 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 13 | 982654 | 982842 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 14 | 2427548 | 2427736 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 15 | 1948289 | 1948474 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 16 | 1148582 | 1148770 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 17 | 2883218 | 2883406 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 18 | 1627201 | 1627389 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 19 | 550583 | 550768 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 20 | 513996 | 514184 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 21 | 1049402 | 1049590 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 22 | 1347099 | 1347287 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 23 | 1246000 | 1246188 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 24 | 1294287 | 1294472 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 25 | 2095667 | 2095855 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 26 | 740332 | 740520 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 27 | 1958003 | 1958191 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 28 | 1103145 | 1103333 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 29 | 1033045 | 1033233 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 30 | 771857 | 772045 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 31 | 2914201 | 2914389 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 32 | 913572 | 913760 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 33 | 914746 | 914934 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 34 | 1463394 | 1463582 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 35 | 1051130 | 1051315 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 36 | 1583028 | 1583213 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 37 | 1051107 | 1051295 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 38 | 1409852 | 1410040 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 39 | 1452122 | 1452310 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 40 | 1045053 | 1045238 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 41 | 898561 | 898746 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 42 | 1015007 | 1015195 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 43 | 1347346 | 1347525 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 44 | 988611 | 988796 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 45 | 952469 | 952654 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 46 | 3525230 | 3525409 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 47 | 1047176 | 1047361 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 48 | 1149740 | 1149928 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 49 | 1850409 | 1850594 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 50 | 1244477 | 1244653 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 51 | 1417981 | 1418160 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 52 | 1030765 | 1030953 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 53 | 1538726 | 1538902 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 54 | 1317785 | 1317964 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 55 | 1102801 | 1102980 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 56 | 781934 | 782113 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 57 | 355173 | 355358 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 58 | 1720049 | 1720228 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 59 | 2176685 | 2176870 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 60 | 1293902 | 1294081 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 61 | 1840615 | 1840794 | - | NZ_CP065211.1 | Enterococcus lactis |
| 62 | 2568913 | 2569092 | - | NZ_CP023011.2 | Enterococcus hirae |
| 63 | 887459 | 887638 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 64 | 1406890 | 1407075 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 65 | 836901 | 837080 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 66 | 716219 | 716398 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 67 | 475564 | 475749 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 68 | 703198 | 703377 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 69 | 722496 | 722675 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 70 | 564745 | 564933 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 71 | 1148039 | 1148227 | - | NZ_CP047361.1 | Macrococcus canis |
| 72 | 393759 | 393944 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 73 | 1586812 | 1586997 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 74 | 416198 | 416383 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 75 | 323023 | 323208 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 76 | 730558 | 730743 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 77 | 1305926 | 1306111 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 78 | 2542631 | 2542816 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 79 | 1291014 | 1291199 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 80 | 1523296 | 1523481 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 81 | 1343014 | 1343199 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 82 | 787303 | 787488 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 83 | 1791094 | 1791279 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 84 | 500201 | 500380 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 85 | 753633 | 753818 | + | NZ_CP027563.1 | Weissella confusa |
| 86 | 680741 | 680926 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 87 | 877275 | 877451 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 88 | 487656 | 487841 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 89 | 697650 | 697829 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 90 | 1369561 | 1369746 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 91 | 1433956 | 1434141 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 92 | 601245 | 601430 | + | NZ_CP061835.1 | Weissella viridescens |
| 93 | 1092105 | 1092290 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 94 | 601122 | 601307 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 95 | 1469757 | 1469942 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 96 | 2517495 | 2517680 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 97 | 1265947 | 1266132 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 98 | 1458443 | 1458628 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 99 | 2554541 | 2554726 | + | NZ_LT906444.1 | Listeria welshimeri |
| 100 | 2668398 | 2668583 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 101 | 2643753 | 2643938 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 102 | 188651 | 188830 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 103 | 1624129 | 1624314 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 104 | 1471955 | 1472140 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 105 | 1342896 | 1343081 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 106 | 1547756 | 1547941 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 107 | 1322302 | 1322490 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 108 | 2041519 | 2041704 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 109 | 1160440 | 1160625 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 110 | 873281 | 873466 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 111 | 1612070 | 1612255 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 112 | 36832 | 37020 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 113 | 3807186 | 3807371 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 114 | 1244514 | 1244699 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 115 | 2379395 | 2379580 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 116 | 4693974 | 4694159 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 117 | 1491665 | 1491850 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 118 | 1323566 | 1323751 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 119 | 4012513 | 4012698 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 120 | 1027767 | 1027952 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 121 | 1267541 | 1267726 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 122 | 2540244 | 2540429 | + | NZ_LR134483.1 | Listeria grayi |
| 123 | 307188 | 307373 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 124 | 766975 | 767160 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 125 | 4065740 | 4065925 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 126 | 1538326 | 1538514 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 127 | 3251164 | 3251352 | + | NZ_CP012024.1 | Bacillus smithii |
| 128 | 2725562 | 2725747 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 129 | 3955329 | 3955514 | + | NZ_LS483476.1 | Lederbergia lentus |
| 130 | 39342 | 39527 | - | NZ_CP040336.1 | Bacillus luti |
| 131 | 5113384 | 5113569 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 132 | 5136481 | 5136666 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 133 | 5301894 | 5302079 | + | NC_011725.1 | Bacillus cereus B4264 |
| 134 | 5338621 | 5338806 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 135 | 3707469 | 3707654 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 136 | 3950263 | 3950448 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 137 | 2338356 | 2338541 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 138 | 2130419 | 2130604 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 139 | 1018632 | 1018817 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 140 | 1906798 | 1906983 | - | NZ_CP043404.1 | Bacillus safensis |
| 141 | 1633230 | 1633412 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 142 | 450938 | 451126 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 143 | 2071298 | 2071486 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 144 | 4455979 | 4456164 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 145 | 3324958 | 3325146 | - | NZ_CP014342.1 | Geobacillus subterraneus |
++ More..