Result : Q88VC6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein lp_2135 |
| NCBI Accession ID | AL935263.2 |
| Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
| Left | 1927079 |
| Right | 1927381 |
| Strand | - |
| Nucleotide Sequence | ATGGATTTTACAGTTAAACCGCGCCGGTCGCTCATCGTTTATATGCATTCGATGAAGCAGGTGCGTCAATTGAAACGTTTTGGATTAATTCAATACCAATCGCGTAAAGAGCATTATGTGGTCTTGTACATGGATGAAAGTCAAATTCCGGCCGCGACCACGAAAATCAAAAAATTAAATTTTGTCCGCAGGGTTGAACCGTCATACCGCCCGGACGTTGCAATGAACTTTGGCGAACGTGTGGATCAAGGCTTTTTTAAGCCAACCACGACTGGTGCGCCTGATGACGATGATGAGGATTAA |
| Sequence | MDFTVKPRRSLIVYMHSMKQVRQLKRFGLIQYQSRKEHYVVLYMDESQIPAATTKIKKLNFVRRVEPSYRPDVAMNFGERVDQGFFKPTTTGAPDDDDED |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 12566566 22156394 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | Q88VC6 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1564824 | 1565126 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 2 | 2168066 | 2168374 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 3 | 674172 | 674429 | + | NZ_CP039712.1 | Vagococcus zengguangii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032757.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00383.25 | 0.67 | 2 | 3008.5 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 2 | PF12836.9 | 0.67 | 2 | 2215.0 | same-strand | Helix-hairpin-helix motif |
| 3 | PF10531.11 | 0.67 | 2 | 2215.0 | same-strand | SLBB domain |
| 4 | PF00633.25 | 0.67 | 2 | 2215.0 | same-strand | Helix-hairpin-helix motif |
| 5 | PF13180.8 | 1.0 | 3 | 1067 | same-strand | PDZ domain |
| 6 | PF01467.28 | 1.0 | 3 | 583 | same-strand | Cytidylyltransferase-like |
| 7 | PF03602.17 | 1.0 | 3 | 70 | same-strand | Conserved hypothetical protein 95 |
| 8 | PF02786.19 | 1.0 | 3 | 546 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 9 | PF02436.20 | 1.0 | 3 | 546 | same-strand | Conserved carboxylase domain |
| 10 | PF00289.24 | 1.0 | 3 | 546 | same-strand | Biotin carboxylase, N-terminal domain |
| 11 | PF02785.21 | 1.0 | 3 | 546 | same-strand | Biotin carboxylase C-terminal domain |
| 12 | PF00682.21 | 1.0 | 3 | 546 | same-strand | HMGL-like |
| 13 | PF00364.24 | 1.0 | 3 | 546 | same-strand | Biotin-requiring enzyme |
| 14 | PF02222.24 | 1.0 | 3 | 546 | same-strand | ATP-grasp domain |
| 15 | PF02655.16 | 1.0 | 3 | 546 | same-strand | ATP-grasp domain |
| 16 | PF01098.21 | 1.0 | 3 | 4008 | same-strand | Cell cycle protein |
| 17 | PF13641.8 | 0.67 | 2 | 7439.5 | same-strand | Glycosyltransferase like family 2 |
| 18 | PF00535.28 | 0.67 | 2 | 7439.5 | same-strand | Glycosyl transferase family 2 |
| 19 | PF13632.8 | 0.67 | 2 | 7439.5 | same-strand | Glycosyl transferase family group 2 |
| 20 | PF13506.8 | 0.67 | 2 | 7439.5 | same-strand | Glycosyl transferase family 21 |
| 21 | PF17820.3 | 0.67 | 2 | 1110.0 | same-strand | PDZ domain |
++ More..