Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0298 protein lp_2135 |
NCBI Accession ID | AL935263.2 |
Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
Left | 1927079 |
Right | 1927381 |
Strand | - |
Nucleotide Sequence | ATGGATTTTACAGTTAAACCGCGCCGGTCGCTCATCGTTTATATGCATTCGATGAAGCAGGTGCGTCAATTGAAACGTTTTGGATTAATTCAATACCAATCGCGTAAAGAGCATTATGTGGTCTTGTACATGGATGAAAGTCAAATTCCGGCCGCGACCACGAAAATCAAAAAATTAAATTTTGTCCGCAGGGTTGAACCGTCATACCGCCCGGACGTTGCAATGAACTTTGGCGAACGTGTGGATCAAGGCTTTTTTAAGCCAACCACGACTGGTGCGCCTGATGACGATGATGAGGATTAA |
Sequence | MDFTVKPRRSLIVYMHSMKQVRQLKRFGLIQYQSRKEHYVVLYMDESQIPAATTKIKKLNFVRRVEPSYRPDVAMNFGERVDQGFFKPTTTGAPDDDDED |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
Pubmed ID | 12566566 22156394 |
Domain | CDD:420011 |
Functional Category | Others |
Uniprot ID | Q88VC6 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1564824 | 1565126 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
2 | 2168066 | 2168374 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
3 | 674172 | 674429 | + | NZ_CP039712.1 | Vagococcus zengguangii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00383.25 | 0.67 | 2 | 3008.5 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
2 | PF12836.9 | 0.67 | 2 | 2215.0 | same-strand | Helix-hairpin-helix motif |
3 | PF10531.11 | 0.67 | 2 | 2215.0 | same-strand | SLBB domain |
4 | PF00633.25 | 0.67 | 2 | 2215.0 | same-strand | Helix-hairpin-helix motif |
5 | PF13180.8 | 1.0 | 3 | 1067 | same-strand | PDZ domain |
6 | PF01467.28 | 1.0 | 3 | 583 | same-strand | Cytidylyltransferase-like |
7 | PF03602.17 | 1.0 | 3 | 70 | same-strand | Conserved hypothetical protein 95 |
8 | PF02786.19 | 1.0 | 3 | 546 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
9 | PF02436.20 | 1.0 | 3 | 546 | same-strand | Conserved carboxylase domain |
10 | PF00289.24 | 1.0 | 3 | 546 | same-strand | Biotin carboxylase, N-terminal domain |
11 | PF02785.21 | 1.0 | 3 | 546 | same-strand | Biotin carboxylase C-terminal domain |
12 | PF00682.21 | 1.0 | 3 | 546 | same-strand | HMGL-like |
13 | PF00364.24 | 1.0 | 3 | 546 | same-strand | Biotin-requiring enzyme |
14 | PF02222.24 | 1.0 | 3 | 546 | same-strand | ATP-grasp domain |
15 | PF02655.16 | 1.0 | 3 | 546 | same-strand | ATP-grasp domain |
16 | PF01098.21 | 1.0 | 3 | 4008 | same-strand | Cell cycle protein |
17 | PF13641.8 | 0.67 | 2 | 7439.5 | same-strand | Glycosyltransferase like family 2 |
18 | PF00535.28 | 0.67 | 2 | 7439.5 | same-strand | Glycosyl transferase family 2 |
19 | PF13632.8 | 0.67 | 2 | 7439.5 | same-strand | Glycosyl transferase family group 2 |
20 | PF13506.8 | 0.67 | 2 | 7439.5 | same-strand | Glycosyl transferase family 21 |
21 | PF17820.3 | 0.67 | 2 | 1110.0 | same-strand | PDZ domain |