Result : Q88VB7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0223 protein lp_2149 |
| NCBI Accession ID | AL935263.2 |
| Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
| Left | 1941588 |
| Right | 1941881 |
| Strand | - |
| Nucleotide Sequence | ATGAAGATGCCTAAACACAATGATAATTACCAATATCCACTGGATGAGACGTGGACCACGGCCGAGATCATTAAGGTTACGACCTTTTATCAAGCCATCGAGGCCGCTAATGAAGGAACAATCGCTACAGCAGACTTGTTGGCAGCCTATCGTGATTTTAAGACGGTCGTTCCGGCTAAGTCGGAAGAAAAACGACTGGCTCGTGATTATGAGGCTGCTTCAGGTTATCGGATTTATCAAACAATGCGCGCAGCTCAGGAAACTAACAAGCAGCGATTTCAATACCGAGACTAG |
| Sequence | MKMPKHNDNYQYPLDETWTTAEIIKVTTFYQAIEAANEGTIATADLLAAYRDFKTVVPAKSEEKRLARDYEAASGYRIYQTMRAAQETNKQRFQYRD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 12566566 22156394 |
| Domain | CDD:420035 |
| Functional Category | Others |
| Uniprot ID | Q88VB7 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1579333 | 1579626 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 2 | 2182828 | 2183121 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 3 | 1791407 | 1791694 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 4 | 1581109 | 1581387 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 5 | 824159 | 824437 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 6 | 691644 | 691934 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 7 | 2565339 | 2565608 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 8 | 1904340 | 1904612 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 9 | 1463364 | 1463612 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 10 | 1263119 | 1263400 | + | NC_014334.2 | Lacticaseibacillus paracasei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030105.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.7 | 7 | 973 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF00679.26 | 0.7 | 7 | 973 | same-strand | Elongation factor G C-terminus |
| 3 | PF03144.27 | 0.7 | 7 | 973 | same-strand | Elongation factor Tu domain 2 |
| 4 | PF01926.25 | 0.8 | 8 | 973.5 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF00459.27 | 1.0 | 10 | 0.0 | same-strand | Inositol monophosphatase family |
| 6 | PF07992.16 | 0.8 | 8 | 1377.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 7 | PF02852.24 | 0.8 | 8 | 1377.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 8 | PF00070.29 | 0.8 | 8 | 1377.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 9 | PF00198.25 | 0.8 | 8 | 2805.0 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
| 10 | PF00364.24 | 0.8 | 8 | 2866 | same-strand | Biotin-requiring enzyme |
| 11 | PF02817.19 | 0.8 | 8 | 2805.0 | same-strand | e3 binding domain |
| 12 | PF02780.22 | 0.7 | 7 | 4202 | same-strand | Transketolase, C-terminal domain |
| 13 | PF02779.26 | 0.7 | 7 | 4202 | same-strand | Transketolase, pyrimidine binding domain |
| 14 | PF00676.22 | 0.6 | 6 | 5139.5 | same-strand | Dehydrogenase E1 component |
++ More..