Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0223 protein lp_2149 |
NCBI Accession ID | AL935263.2 |
Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
Left | 1941588 |
Right | 1941881 |
Strand | - |
Nucleotide Sequence | ATGAAGATGCCTAAACACAATGATAATTACCAATATCCACTGGATGAGACGTGGACCACGGCCGAGATCATTAAGGTTACGACCTTTTATCAAGCCATCGAGGCCGCTAATGAAGGAACAATCGCTACAGCAGACTTGTTGGCAGCCTATCGTGATTTTAAGACGGTCGTTCCGGCTAAGTCGGAAGAAAAACGACTGGCTCGTGATTATGAGGCTGCTTCAGGTTATCGGATTTATCAAACAATGCGCGCAGCTCAGGAAACTAACAAGCAGCGATTTCAATACCGAGACTAG |
Sequence | MKMPKHNDNYQYPLDETWTTAEIIKVTTFYQAIEAANEGTIATADLLAAYRDFKTVVPAKSEEKRLARDYEAASGYRIYQTMRAAQETNKQRFQYRD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
Pubmed ID | 12566566 22156394 |
Domain | CDD:420035 |
Functional Category | Others |
Uniprot ID | Q88VB7 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1579333 | 1579626 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
2 | 2182828 | 2183121 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
3 | 1791407 | 1791694 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
4 | 1581109 | 1581387 | + | NZ_CP016953.1 | Streptococcus himalayensis |
5 | 824159 | 824437 | + | NZ_AP018400.1 | Streptococcus ruminantium |
6 | 691644 | 691934 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
7 | 2565339 | 2565608 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
8 | 1904340 | 1904612 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
9 | 1463364 | 1463612 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
10 | 1263119 | 1263400 | + | NC_014334.2 | Lacticaseibacillus paracasei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00009.29 | 0.7 | 7 | 973 | same-strand | Elongation factor Tu GTP binding domain |
2 | PF00679.26 | 0.7 | 7 | 973 | same-strand | Elongation factor G C-terminus |
3 | PF03144.27 | 0.7 | 7 | 973 | same-strand | Elongation factor Tu domain 2 |
4 | PF01926.25 | 0.8 | 8 | 973.5 | same-strand | 50S ribosome-binding GTPase |
5 | PF00459.27 | 1.0 | 10 | 0.0 | same-strand | Inositol monophosphatase family |
6 | PF07992.16 | 0.8 | 8 | 1377.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
7 | PF02852.24 | 0.8 | 8 | 1377.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
8 | PF00070.29 | 0.8 | 8 | 1377.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
9 | PF00198.25 | 0.8 | 8 | 2805.0 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
10 | PF00364.24 | 0.8 | 8 | 2866 | same-strand | Biotin-requiring enzyme |
11 | PF02817.19 | 0.8 | 8 | 2805.0 | same-strand | e3 binding domain |
12 | PF02780.22 | 0.7 | 7 | 4202 | same-strand | Transketolase, C-terminal domain |
13 | PF02779.26 | 0.7 | 7 | 4202 | same-strand | Transketolase, pyrimidine binding domain |
14 | PF00676.22 | 0.6 | 6 | 5139.5 | same-strand | Dehydrogenase E1 component |