| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0237 protein lp_2508 |
| NCBI Accession ID | |
| Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MKAIITVVGQDQVGIVAKVANELARLKINIVDISQTLMDHNFTMMLSAEWDDQQLSFAAAKAALESLGEASELTIRIQRQAVFDAIQKL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding. |
| Pubmed ID | 12566566 22156394 |
| Domain | CDD:415594 |
| Functional Category | Others |
| Uniprot ID | Q88UH8 |
| ORF Length (Amino Acid) | 89 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1833879 | 1834148 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 2 | 2499855 | 2500124 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 3 | 1399473 | 1399742 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 4 | 94205 | 94474 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 5 | 2310279 | 2310545 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 6 | 1798952 | 1799221 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 7 | 342779 | 343048 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 8 | 1621230 | 1621499 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 9 | 1322981 | 1323250 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 10 | 572528 | 572794 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 11 | 1767170 | 1767439 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 12 | 1597134 | 1597400 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 13 | 540829 | 541098 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 14 | 1900858 | 1901124 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 15 | 1973012 | 1973278 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 16 | 1811748 | 1812014 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 17 | 1394721 | 1394990 | + | NZ_CP009312.1 | Lawsonella clevelandensis |
| 18 | 121609 | 121875 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05167.14 | 1.0 | 18 | 12.0 | same-strand | Uncharacterised ACR (DUF711) |