Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0337 protein PP_2059 |
NCBI Accession ID | AE015451.2 |
Organism | Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) |
Left | 2343455 |
Right | 2343703 |
Strand | - |
Nucleotide Sequence | ATGAAACGCGAACAGATCGAAGGTGTAGCAGAAGACCTGGCTGGCAAGGCGCAAAGCGCCGTAGGTCGCCTGGTCGAAGACCCGGCGCTGGAAGCCGAAGGCGATGCGCGTCAGGCCGCAGGCCAGGTGACCAAGACCTACGGCGACACCCTGGACACGGTGTCCTCGTTCGTCAAGGAAAAGCCCTTCGCCGCACTGGCCATCACCGCCGCCGTCACACTGGTGGTCTCTCGCCTGCTGCGCCGCTGA |
Sequence | MKREQIEGVAEDLAGKAQSAVGRLVEDPALEAEGDARQAAGQVTKTYGDTLDTVSSFVKEKPFAALAITAAVTLVVSRLLRR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional |
Pubmed ID | 12534463 |
Domain | CDD:419889 |
Functional Category | Others |
Uniprot ID | Q88L76 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4316287 | 4316535 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
2 | 2193653 | 2193901 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
3 | 3204994 | 3205242 | - | NZ_CP027756.1 | Pseudomonas synxantha |
4 | 2669958 | 2670209 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
5 | 3896905 | 3897156 | + | NZ_CP012400.2 | Pseudomonas yamanorum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07865.13 | 0.6 | 3 | 12 | same-strand | Protein of unknown function (DUF1652) |
2 | PF00196.21 | 0.6 | 3 | 150 | same-strand | Bacterial regulatory proteins, luxR family |