Result : Q88L76

Protein Information

• Protein name: UPF0337 protein PP_2059
• NCBI Accession ID: AE015451.2
• Organism: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
• Left: 2343455
• Right: 2343703
• Strand: -
• Nucleotide Sequence: ATGAAACGCGAACAGATCGAAGGTGTAGCAGAAGACCTGGCTGGCAAGGCGCAAAGCGCCGTAGGTCGCCTGGTCGAAGACCCGGCGCTGGAAGCCGAAGGCGATGCGCGTCAGGCCGCAGGCCAGGTGACCAAGACCTACGGCGACACCCTGGACACGGTGTCCTCGTTCGTCAAGGAAAAGCCCTTCGCCGCACTGGCCATCACCGCCGCCGTCACACTGGTGGTCTCTCGCCTGCTGCGCCGCTGA
• Sequence: MKREQIEGVAEDLAGKAQSAVGRLVEDPALEAEGDARQAAGQVTKTYGDTLDTVSSFVKEKPFAALAITAAVTLVVSRLLRR
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional
• Pubmed ID: 12534463
• Domain: CDD:419889
• Functional Category: Others
• Uniprot ID: Q88L76
• ORF Length (Amino Acid): 82

Conservation Analysis

No. of Species: 5

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4316287	4316535	+	NC_021505.1	Pseudomonas putida NBRC 14164
2	2193653	2193901	+	NZ_CP009533.1	Pseudomonas rhizosphaerae
3	3204994	3205242	-	NZ_CP027756.1	Pseudomonas synxantha
4	2669958	2670209	+	NZ_CP061079.1	Pseudomonas chlororaphis
5	3896905	3897156	+	NZ_CP012400.2	Pseudomonas yamanorum

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP061079.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07865.13	0.6	3	12	same-strand	Protein of unknown function (DUF1652)
2	PF00196.21	0.6	3	150	same-strand	Bacterial regulatory proteins, luxR family