Protein Information |
Information Type | Description |
---|---|
Protein name | PqqA binding protein 2 (Coenzyme PQQ synthesis protein D 2) (Pyrroloquinoline quinone biosynthesis protein D 2) |
NCBI Accession ID | AE015451.2 |
Organism | Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) |
Left | 3070786 |
Right | 3071058 |
Strand | + |
Nucleotide Sequence | GTGAACCTGATTGATCGCCAGCAGGCCCTTGCCTTGGGGCGAGGCTTGCGCCTGGACTGGGAGCCACGGAAGGCTTGCCACGTGCTGTTGTACGCCGGGGGCATCATCGAGCTCAATGCCAGTGCCGGCTGGGTCCTCGAGCTGCTGGACGGCCACAGTACCGTGGCAACGGTCATCGACCGCCTGGCACAACGCTTCCCCAATGTACCGGGGCTCGAAGAGGACGTACTGGCGTTTCTGGAGGTGGCCCGCGCCAAATCCTGGATAGAATGA |
Sequence | MNLIDRQQALALGRGLRLDWEPRKACHVLLYAGGIIELNASAGWVLELLDGHSTVATVIDRLAQRFPNVPGLEEDVLAFLEVARAKSWIE |
Source of smORF | Swiss-Prot |
Function | Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway. |
Pubmed ID | 12534463 |
Domain | CDD:414309 |
Functional Category | Others |
Uniprot ID | Q88JG8 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4546933 | 4547205 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
2 | 3538012 | 3538284 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
3 | 1813203 | 1813481 | + | NZ_AP022642.1 | Pseudomonas otitidis |
4 | 2651489 | 2651770 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
5 | 2261147 | 2261428 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
6 | 2456906 | 2457187 | + | NZ_CP060009.1 | Pseudomonas sediminis |
7 | 48338 | 48616 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
8 | 3220662 | 3220940 | - | NZ_CP068551.1 | Pseudomonas khazarica |
9 | 3537760 | 3538038 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
10 | 2173662 | 2173940 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
11 | 4088640 | 4088894 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
12 | 3120245 | 3120502 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
13 | 71590 | 71865 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
14 | 4199558 | 4199803 | - | NC_012560.1 | Azotobacter vinelandii DJ |
15 | 952989 | 953237 | + | NZ_CP011835.1 | Azotobacter chroococcum |
16 | 419219 | 419473 | - | NC_008027.1 | Pseudomonas entomophila L48 |
17 | 1726259 | 1726504 | - | NZ_CP045302.1 | Azotobacter salinestris |
18 | 2831793 | 2832038 | + | NC_018691.1 | Alcanivorax dieselolei B5 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02518.28 | 0.61 | 11 | 4196.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
2 | PF00072.26 | 0.67 | 12 | 4185 | same-strand | Response regulator receiver domain |
3 | PF00512.27 | 0.61 | 11 | 4196.0 | same-strand | His Kinase A (phospho-acceptor) domain |
4 | PF00465.21 | 0.61 | 11 | 3038 | same-strand | Iron-containing alcohol dehydrogenase |
5 | PF04055.23 | 1.0 | 18 | -28.0 | same-strand | Radical SAM superfamily |
6 | PF13186.8 | 1.0 | 18 | -28.0 | same-strand | Iron-sulfur cluster-binding domain |
7 | PF03070.18 | 1.0 | 18 | 22.5 | same-strand | TENA/THI-4/PQQC family |
8 | PF12706.9 | 0.94 | 17 | 822.0 | same-strand | Beta-lactamase superfamily domain |
9 | PF00171.24 | 0.61 | 11 | 2200 | same-strand | Aldehyde dehydrogenase family |
10 | PF00326.23 | 0.89 | 16 | 1117.0 | same-strand | Prolyl oligopeptidase family |