Result : Q87Y82
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein PSPTO_3921 |
| NCBI Accession ID | AE016853.1 |
| Organism | Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) |
| Left | 4434655 |
| Right | 4434948 |
| Strand | - |
| Nucleotide Sequence | TTGAAGCGTATCTGCTCGATTTATCGCAGCCCGAAAAGAAACGAGATGTACCTTTACGTCTTGAAGAGCGACGTCCTCAAGCGCGTGCCGCCAGAGCTGCTGGTGGCGTTCGGCAAACCGGTTCATGCATTTGATCTGGTGCTGAGCCCCGAGCGTGCGCTGTCGCGCGAAGATATCAATGCGGTGCTGAAGAACCTCGACAGCCAGGGCTATCACTTGCAGATGCCTCCCGCTGAAGATGAATACATCGAGCATTTGCCCGAAGAGCTGCTGCGCCGCAACGACCCCATGTGA |
| Sequence | MKRICSIYRSPKRNEMYLYVLKSDVLKRVPPELLVAFGKPVHAFDLVLSPERALSREDINAVLKNLDSQGYHLQMPPAEDEYIEHLPEELLRRNDPM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | 12928499 |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | Q87Y82 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4434655 | 4434948 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 2 | 1783110 | 1783403 | + | NZ_CP068034.2 | Pseudomonas syringae |
| 3 | 1745823 | 1746116 | + | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 4 | 1865446 | 1865739 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 5 | 4315561 | 4315854 | - | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 6 | 887473 | 887766 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 7 | 2342505 | 2342798 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 8 | 1620470 | 1620763 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 9 | 2567897 | 2568190 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 10 | 1609444 | 1609737 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 11 | 1605101 | 1605394 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 12 | 4933910 | 4934203 | - | NZ_CP012400.2 | Pseudomonas yamanorum |
| 13 | 1653498 | 1653791 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 14 | 5055473 | 5055766 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 15 | 1710802 | 1711095 | + | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 16 | 5184194 | 5184487 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 17 | 2233451 | 2233744 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 18 | 68860 | 69153 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 19 | 1623562 | 1623855 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 20 | 5158956 | 5159249 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 21 | 1823156 | 1823449 | + | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 22 | 1391951 | 1392244 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 23 | 1576150 | 1576443 | + | NZ_CP071706.1 | Pseudomonas donghuensis |
| 24 | 1597650 | 1597943 | + | NZ_CP027723.1 | Pseudomonas orientalis |
| 25 | 1708275 | 1708568 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 26 | 4415253 | 4415546 | - | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 27 | 1675043 | 1675336 | + | NZ_CP010896.1 | Pseudomonas simiae |
| 28 | 4398847 | 4399140 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 29 | 4331003 | 4331296 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 30 | 1830737 | 1831030 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 31 | 4261889 | 4262182 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 32 | 4530496 | 4530789 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 33 | 1634065 | 1634358 | + | NZ_CP023272.1 | Pseudomonas lurida |
| 34 | 415934 | 416227 | + | NZ_CP009365.1 | Pseudomonas soli |
| 35 | 4805250 | 4805543 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 36 | 3077225 | 3077518 | - | NZ_LR215729.2 | Pseudomonas marincola |
| 37 | 4913668 | 4913961 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 38 | 1585606 | 1585899 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 39 | 4183089 | 4183382 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 40 | 4354843 | 4355136 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 41 | 1652841 | 1653134 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 42 | 952848 | 953141 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 43 | 4998628 | 4998921 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 44 | 4214879 | 4215172 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 45 | 4400204 | 4400497 | - | NZ_CP014205.2 | Pseudomonas glycinae |
| 46 | 1629018 | 1629311 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 47 | 2020394 | 2020687 | + | NZ_CP068551.1 | Pseudomonas khazarica |
| 48 | 2810764 | 2811063 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 49 | 4234319 | 4234555 | + | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 50 | 3373485 | 3373778 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 51 | 3312211 | 3312459 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 52 | 1406459 | 1406752 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 53 | 3135647 | 3135895 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 54 | 4041785 | 4042078 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 55 | 2103354 | 2103647 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 56 | 1857345 | 1857590 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 57 | 3496215 | 3496451 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 58 | 1219166 | 1219456 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 59 | 4035666 | 4035902 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 60 | 3991215 | 3991454 | + | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 61 | 136589 | 136876 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 62 | 2908316 | 2908603 | - | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 63 | 3260932 | 3261222 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 64 | 1000454 | 1000699 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 65 | 815073 | 815357 | - | NZ_CP057657.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004578.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03692.17 | 0.94 | 61 | 1872 | same-strand | Putative zinc- or iron-chelating domain |
| 2 | PF02826.21 | 0.8 | 52 | 106.5 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
| 3 | PF01612.22 | 0.97 | 63 | -3 | same-strand | 3'-5' exonuclease |
| 4 | PF00570.25 | 0.97 | 63 | -3 | same-strand | HRDC domain |
++ More..