ProsmORF-pred
Result : Q87V56
Protein Information
Information Type Description
Protein name Malonate decarboxylase acyl carrier protein (Malonate decarboxylase subunit delta)
NCBI Accession ID AE016853.1
Organism Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Left 5788447
Right 5788746
Strand -
Nucleotide Sequence ATGGAAACCCTGTCTTTTGAATTCCCCGCCGGACAGCCGCCCAAAGGCCGTGCGCTGGTGGGCGTGGTCGGTTCCGGTGATCTGGAAGTACTGCTGGAGCCTGGTCAGCCAGGCAAATTGTCGATTCAGGTGGTGACCTCGGTCAACGGTGCCTCGCTGCGCTGGAAACATCTTTTCGAGCGCATGTTCGATGGCCAGACCCCGCCCGCGCTGAGCATCGACATTCATGACTTCGGCGCAACGCCTGGCGTGGTGCGTCTGCGTCTGGAGCAGGGTTTCGAGGAGATCGGCCATGACTGA
Sequence METLSFEFPAGQPPKGRALVGVVGSGDLEVLLEPGQPGKLSIQVVTSVNGASLRWKHLFERMFDGQTPPALSIDIHDFGATPGVVRLRLEQGFEEIGHD
Source of smORF Swiss-Prot
Function Subunit of malonate decarboxylase, it is an acyl carrier protein to which acetyl and malonyl thioester residues are bound via a 2'-(5''-phosphoribosyl)-3'-dephospho-CoA prosthetic group and turn over during the catalytic mechanism. {ECO:0000255|HAMAP-Rule:MF_00710}.
Pubmed ID 12928499
Domain CDD:414649
Functional Category Others
Uniprot ID Q87V56
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 103
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 318171 318470 + NZ_CP067022.1 Pseudomonas cannabina pv. alisalensis
2 5788447 5788746 - NC_004578.1 Pseudomonas syringae pv. tomato str. DC3000
3 416264 416563 + NZ_CP042804.1 Pseudomonas amygdali pv. tabaci str. ATCC 11528
4 497468 497767 + NZ_CP068034.2 Pseudomonas syringae
5 5524674 5524973 - NZ_CP007039.1 Pseudomonas cichorii JBC1
6 6371681 6371980 - NZ_CP061079.1 Pseudomonas chlororaphis
7 6418640 6418939 - NZ_LS999205.1 Pseudomonas protegens CHA0
8 6265258 6265557 - NZ_CP035088.1 Pseudomonas viciae
9 6320863 6321162 - NZ_CP034725.1 Pseudomonas brassicacearum
10 4360127 4360426 + NZ_CP005960.1 Pseudomonas mandelii JR-1
11 3128094 3128393 - NZ_CP014262.1 Pseudomonas corrugata
12 4639551 4639850 + NZ_CP048810.1 Pseudomonas bijieensis
13 6107021 6107320 - NZ_CP062252.1 Pseudomonas allokribbensis
14 6453743 6454042 - NZ_CP051487.1 Pseudomonas umsongensis
15 5891267 5891566 - NZ_CP029608.1 Pseudomonas kribbensis
16 6427056 6427355 - NZ_CP018420.1 Pseudomonas veronii
17 6390567 6390866 - NZ_CP014870.1 Pseudomonas silesiensis
18 6108416 6108715 - NZ_CP062253.1 Pseudomonas gozinkensis
19 5722619 5722918 - NZ_CP010896.1 Pseudomonas simiae
20 190080 190379 + NZ_CP012400.2 Pseudomonas yamanorum
21 558428 558727 + NZ_CP070503.1 Pseudomonas atacamensis
22 5497087 5497386 - NZ_CP027723.1 Pseudomonas orientalis
23 5680485 5680784 - NZ_CP023272.1 Pseudomonas lurida
24 2813756 2814055 + NZ_CP014205.2 Pseudomonas glycinae
25 5567390 5567689 - NZ_CP054205.1 Pseudomonas rhodesiae
26 6091270 6091569 - NZ_CP027756.1 Pseudomonas synxantha
27 6012338 6012637 - NZ_CP056030.1 Pseudomonas eucalypticola
28 191361 191660 + NZ_AP014862.1 Pseudomonas furukawaii
29 3647304 3647603 - NZ_CP011835.1 Azotobacter chroococcum
30 5866952 5867251 - NZ_AP022642.1 Pseudomonas otitidis
31 96110 96409 - NZ_CP060009.1 Pseudomonas sediminis
32 4858916 4859215 - NZ_CP013124.1 Pseudomonas mendocina S5.2
33 2456779 2457078 + NZ_CP070505.1 Pseudomonas toyotomiensis
34 202684 202983 + NZ_CP068551.1 Pseudomonas khazarica
35 3751460 3751759 + NZ_CP045302.1 Azotobacter salinestris
36 977372 977671 + NC_012560.1 Azotobacter vinelandii DJ
37 854345 854644 + NC_016603.1 Acinetobacter pittii PHEA-2
38 3229926 3230225 - NZ_CP022562.1 Pseudomonas monteilii
39 751588 751887 - NZ_CP031146.1 Pseudomonas plecoglossicida
40 2363851 2364150 - NZ_CP053391.1 Acinetobacter lactucae
41 344455 344754 - NZ_CP070518.1 Acinetobacter calcoaceticus
42 2224553 2224852 - NZ_CP015121.1 Acinetobacter baumannii
43 2688324 2688623 + NC_021505.1 Pseudomonas putida NBRC 14164
44 2479852 2480151 - NC_014259.1 Acinetobacter oleivorans DR1
45 239779 240078 + NC_002516.2 Pseudomonas aeruginosa PAO1
46 1165247 1165549 + NZ_CP041970.1 Acinetobacter dispersus
47 1762168 1762467 + NC_005966.1 Acinetobacter baylyi ADP1
48 1184447 1184743 + NZ_CP016895.1 Acinetobacter larvae
49 1000500 1000823 + NC_008781.1 Polaromonas naphthalenivorans CJ2
50 2732361 2732669 - NZ_CP059560.1 Aromatoleum petrolei
51 6273350 6273658 - NZ_CP046904.1 Massilia flava
52 3377910 3378218 + NZ_CP048832.1 Janthinobacterium lividum
53 4249314 4249631 + NZ_CP043046.1 Pigmentiphaga aceris
54 695279 695593 - NZ_CP062803.1 Cupriavidus basilensis
55 3015438 3015740 - NZ_HG322949.1 Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628
56 4456031 4456330 - NZ_CP023525.1 Cedecea neteri
57 1369698 1370000 + NZ_CP050150.1 Hafnia alvei
58 2504190 2504489 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
59 1455252 1455551 - NZ_CP018787.1 Oxalobacter formigenes
60 666276 666575 - NZ_CP011254.1 Serratia fonticola
61 246662 246961 - NZ_CP011258.1 Ralstonia mannitolilytica
62 2417357 2417674 + NZ_CP011568.3 Pandoraea thiooxydans
63 4160876 4161175 - NZ_LR134201.1 Cedecea lapagei
64 3969484 3969783 - NZ_AP023184.1 Buttiauxella agrestis
65 679009 679320 + NZ_CP019038.1 Massilia putida
66 2854981 2855280 + NZ_CP054254.1 Klebsiella variicola
67 2713946 2714245 - NZ_CP060111.1 Klebsiella michiganensis
68 583719 584018 - NZ_CP065640.1 Serratia rubidaea
69 4000281 4000580 + NZ_CP015137.1 Dickeya solani IPO 2222
70 3907375 3907677 + NZ_CP067057.1 Rahnella aceris
71 3690152 3690451 + NZ_CP020388.1 Pluralibacter gergoviae
72 2718032 2718331 - NZ_CP016337.1 Kosakonia sacchari
73 490986 491294 + NZ_CP022990.1 Paraburkholderia aromaticivorans
74 156274 156588 - NZ_CP022990.1 Paraburkholderia aromaticivorans
75 2689210 2689509 + NZ_CP065838.1 Klebsiella quasipneumoniae
76 4468113 4468412 - NZ_CP063425.1 Kosakonia pseudosacchari
77 2142000 2142299 - NZ_CP054058.1 Scandinavium goeteborgense
78 2627110 2627409 - NZ_CP050508.1 Raoultella terrigena
79 4331472 4331771 - NC_015968.1 Enterobacter soli
80 3536411 3536710 + NZ_CP045300.1 Kosakonia arachidis
81 1954309 1954605 - NZ_CP047241.1 Aquitalea denitrificans
82 428746 429045 + NZ_CP014007.2 Kosakonia oryzae
83 4895216 4895515 - NZ_CP015113.1 Kosakonia radicincitans
84 1801760 1802068 - NZ_CP024941.1 Paraburkholderia terricola
85 4421013 4421312 - NZ_CP009756.1 Enterobacter cloacae
86 4317019 4317318 - NZ_CP017184.1 Enterobacter roggenkampii
87 2982378 2982677 + NZ_CP025034.2 Enterobacter sp. SGAir0187
88 2879509 2879808 - NZ_CP017279.1 Enterobacter ludwigii
89 1460450 1460749 + NZ_CP016023.1 Ralstonia insidiosa
90 2049957 2050256 - NZ_AP019007.1 Enterobacter oligotrophicus
91 4653173 4653472 - NZ_CP043318.1 Enterobacter chengduensis
92 4026758 4027057 + NZ_CP045769.1 Enterobacter cancerogenus
93 845813 846121 + NZ_CP041185.1 Janthinobacterium tructae
94 933095 933409 - NC_010676.1 Paraburkholderia phytofirmans PsJN
95 10923160 10923453 + NZ_CP012159.1 Chondromyces crocatus
96 342031 342333 - NZ_CP046910.1 Paraburkholderia acidiphila
97 940106 940432 + NZ_CP049135.1 Paraburkholderia tropica
98 2188502 2188807 - NC_010623.1 Paraburkholderia phymatum STM815
99 1452238 1452552 - NZ_CP046914.1 Paraburkholderia acidisoli
100 1326564 1326878 - NC_007952.1 Paraburkholderia xenovorans LB400
101 1916905 1917219 + NZ_CP031466.1 Paraburkholderia caffeinilytica
102 2267374 2267667 - NZ_CP016211.1 Minicystis rosea
103 1769732 1770046 + NZ_CP024935.1 Paraburkholderia graminis
104 937939 938253 - NZ_CP066076.1 Paraburkholderia ginsengisoli
105 139418 139732 + NZ_CP024942.1 Paraburkholderia terricola
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP067022.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF16957.7 0.99 102 877.0 same-strand Malonate decarboxylase, alpha subunit, transporter
2 PF01874.18 1.0 103 2 same-strand ATP:dephospho-CoA triphosphoribosyl transferase
3 PF06833.13 1.0 103 841 same-strand Malonate decarboxylase gamma subunit (MdcE)
4 PF10620.11 0.98 101 1693 same-strand Phosphoribosyl-dephospho-CoA transferase MdcG
5 PF00698.23 0.91 94 2363.5 same-strand Acyl transferase domain
++ More..