Result : A9BH64
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP000879.1 |
| Organism | Petrotoga mobilis (strain DSM 10674 / SJ95) |
| Left | 613339 |
| Right | 613569 |
| Strand | + |
| Nucleotide Sequence | ATGGCTTACGTTAAAAAAGAAAGAAAAAGGATAAAAAAATGCAAATTATGCAGGGATAATGTTGAATATATTGATTACAAAGATGTCAGAAAATTAAAAGAGTTTATGAACGATAAAGGAAAAATCCTTCCAAAAAGAATAAATGGAAATTGTGCCAAACATCAAAGAATGGTTCGAACAGCGATACAACGTGCAAGAAAAATGATGTTAGTCCCTTACGTGAACGAGTGA |
| Sequence | MAYVKKERKRIKKCKLCRDNVEYIDYKDVRKLKEFMNDKGKILPKRINGNCAKHQRMVRTAIQRARKMMLVPYVNE |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A9BH64 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 251
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 613339 | 613569 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 2 | 642351 | 642581 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 3 | 735820 | 736050 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 4 | 244894 | 245124 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 5 | 277410 | 277640 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 6 | 446524 | 446748 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 7 | 644052 | 644276 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 8 | 1405974 | 1406162 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 9 | 678603 | 678827 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 10 | 1393144 | 1393383 | - | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 11 | 2919556 | 2919765 | - | NZ_LS974202.1 | Mesotoga infera |
| 12 | 337413 | 337640 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 13 | 1638406 | 1638660 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 14 | 1915942 | 1916181 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 15 | 2094254 | 2094478 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 16 | 357774 | 358004 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 17 | 3033389 | 3033634 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 18 | 2120420 | 2120650 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 19 | 3000257 | 3000451 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 20 | 2325233 | 2325466 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 21 | 3764794 | 3765009 | + | NZ_CP030775.1 | Clostridium butyricum |
| 22 | 3390701 | 3390946 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 23 | 5258898 | 5259128 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 24 | 5092389 | 5092604 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 25 | 4304221 | 4304451 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 26 | 1546712 | 1546942 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 27 | 141663 | 141881 | - | NZ_CP046314.1 | Gemella morbillorum |
| 28 | 1709253 | 1709471 | - | NZ_LR134484.1 | Gemella haemolysans |
| 29 | 418320 | 418550 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 30 | 563226 | 563450 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 31 | 2950838 | 2951068 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 32 | 5924001 | 5924216 | - | NZ_CP043998.1 | Clostridium diolis |
| 33 | 262638 | 262871 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 34 | 286589 | 286822 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 35 | 2247405 | 2247620 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 36 | 4615027 | 4615242 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 37 | 194241 | 194480 | + | NZ_CP014176.1 | Clostridium argentinense |
| 38 | 137605 | 137826 | + | NZ_CP029256.1 | Christensenella minuta |
| 39 | 6514802 | 6515017 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 40 | 4744927 | 4745133 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 41 | 4531757 | 4531987 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 42 | 41663 | 41857 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 43 | 2855016 | 2855261 | - | NZ_CP016786.1 | Clostridium isatidis |
| 44 | 48393 | 48617 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 45 | 2724184 | 2724423 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 46 | 3056858 | 3057073 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 47 | 2805029 | 2805244 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 48 | 2370893 | 2371117 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 49 | 5447816 | 5448031 | - | NZ_CP020953.1 | Clostridium drakei |
| 50 | 4596241 | 4596456 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 51 | 4473562 | 4473777 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 52 | 713685 | 713915 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 53 | 4842171 | 4842401 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 54 | 1071741 | 1071971 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 55 | 66689 | 66919 | + | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 56 | 1602669 | 1602899 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 57 | 4336253 | 4336459 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 58 | 3153351 | 3153581 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 59 | 2001509 | 2001760 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 60 | 3606765 | 3606995 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 61 | 5835375 | 5835605 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 62 | 41729 | 41953 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 63 | 3841438 | 3841680 | - | NZ_CP028842.1 | Clostridium botulinum |
| 64 | 3240554 | 3240796 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 65 | 3548116 | 3548310 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 66 | 132249 | 132464 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 67 | 236236 | 236445 | + | NZ_CP048649.1 | Aminipila butyrica |
| 68 | 49283 | 49516 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 69 | 2256147 | 2256371 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 70 | 104042 | 104275 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 71 | 4124778 | 4125020 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 72 | 25221 | 25442 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 73 | 121910 | 122104 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 74 | 3075934 | 3076164 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 75 | 3790297 | 3790524 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 76 | 121495 | 121689 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 77 | 1234332 | 1234550 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 78 | 2354855 | 2355088 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 79 | 34198 | 34422 | + | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 80 | 34198 | 34422 | + | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 81 | 1440231 | 1440461 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 82 | 29111 | 29341 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 83 | 3949852 | 3950082 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 84 | 2896190 | 2896414 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 85 | 65088 | 65303 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 86 | 90325 | 90540 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 87 | 1213096 | 1213320 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 88 | 307073 | 307282 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 89 | 1362378 | 1362614 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 90 | 2740337 | 2740561 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 91 | 1269151 | 1269366 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 92 | 2565568 | 2565762 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 93 | 3929923 | 3930129 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 94 | 3076309 | 3076524 | - | NZ_CP014204.2 | Clostridium baratii |
| 95 | 1545891 | 1546118 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 96 | 3335716 | 3335946 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 97 | 3368676 | 3368906 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 98 | 4795029 | 4795259 | - | NZ_CP036259.1 | Sporomusa termitida |
| 99 | 4844703 | 4844897 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 100 | 25252 | 25476 | + | NZ_CP013197.1 | Spiroplasma citri |
| 101 | 4897121 | 4897315 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 102 | 1875019 | 1875258 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 103 | 1619815 | 1620048 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 104 | 173253 | 173495 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 105 | 1437417 | 1437662 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 106 | 910847 | 911071 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 107 | 2767344 | 2767538 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 108 | 2626175 | 2626384 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 109 | 959989 | 960231 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 110 | 2197057 | 2197299 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 111 | 2414223 | 2414465 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 112 | 1374035 | 1374277 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 113 | 2547483 | 2547725 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 114 | 12573 | 12809 | + | NC_008593.1 | Clostridium novyi NT |
| 115 | 1442611 | 1442835 | - | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 116 | 3611401 | 3611595 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 117 | 4031354 | 4031581 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 118 | 89387 | 89614 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 119 | 2412073 | 2412273 | - | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 120 | 2634711 | 2634953 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 121 | 171900 | 172142 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 122 | 331050 | 331238 | + | NZ_HF545617.1 | Ruminococcus bicirculans |
| 123 | 650986 | 651198 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 124 | 2912346 | 2912570 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 125 | 11985 | 12224 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 126 | 1021518 | 1021754 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 127 | 2019620 | 2019832 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 128 | 1234896 | 1235144 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 129 | 2594772 | 2594984 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 130 | 24267 | 24488 | + | NC_022998.1 | Spiroplasma apis B31 |
| 131 | 24281 | 24502 | + | NZ_CP017015.1 | Spiroplasma helicoides |
| 132 | 1455801 | 1456040 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 133 | 1670534 | 1670773 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 134 | 1690094 | 1690333 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 135 | 884978 | 885217 | + | NZ_LR134293.1 | Streptococcus canis |
| 136 | 1516066 | 1516305 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 137 | 1821641 | 1821880 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 138 | 702556 | 702789 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 139 | 2183834 | 2184073 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 140 | 750867 | 751103 | - | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 141 | 812535 | 812777 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 142 | 53826 | 54068 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 143 | 1569144 | 1569386 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 144 | 687896 | 688126 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 145 | 251253 | 251465 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 146 | 254177 | 254404 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 147 | 344001 | 344240 | + | NZ_LT821227.1 | Phoenicibacter congonensis |
| 148 | 3533495 | 3533704 | - | NZ_LR699011.1 | Roseburia hominis |
| 149 | 4340840 | 4341049 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 150 | 2361156 | 2361398 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 151 | 1054959 | 1055201 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 152 | 25062 | 25286 | + | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 153 | 4068700 | 4068894 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 154 | 830712 | 830936 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 155 | 388249 | 388491 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 156 | 878106 | 878351 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 157 | 8553 | 8756 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 158 | 2554432 | 2554644 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 159 | 1264846 | 1265034 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 160 | 3203579 | 3203767 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 161 | 673723 | 673956 | - | NZ_LT996885.1 | Dialister massiliensis |
| 162 | 4626725 | 4626943 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 163 | 24289 | 24510 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 164 | 1784130 | 1784357 | - | NZ_CP070062.1 | Coprococcus comes |
| 165 | 4185890 | 4186075 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 166 | 434150 | 434395 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 167 | 852832 | 853074 | - | NC_016940.1 | Saprospira grandis str. Lewin |
| 168 | 25911 | 26132 | + | NZ_CP024870.1 | Spiroplasma clarkii |
| 169 | 1001929 | 1002159 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 170 | 24335 | 24556 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 171 | 209191 | 209427 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 172 | 3113649 | 3113846 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 173 | 5184942 | 5185172 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 174 | 3989901 | 3990143 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 175 | 40525 | 40758 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 176 | 5213716 | 5213910 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 177 | 3527648 | 3527884 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 178 | 292108 | 292344 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 179 | 2413269 | 2413505 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 180 | 1587203 | 1587418 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 181 | 3245941 | 3246177 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 182 | 24347 | 24568 | + | NZ_CP012622.1 | Spiroplasma cantharicola |
| 183 | 2676883 | 2677119 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 184 | 2789570 | 2789806 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 185 | 498628 | 498864 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 186 | 5236789 | 5236983 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 187 | 5434274 | 5434468 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 188 | 5133419 | 5133613 | + | NZ_CP040336.1 | Bacillus luti |
| 189 | 5405331 | 5405525 | - | NC_011725.1 | Bacillus cereus B4264 |
| 190 | 147032 | 147274 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 191 | 631066 | 631302 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 192 | 44739 | 44945 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 193 | 31403 | 31636 | + | NZ_CP009687.1 | Clostridium aceticum |
| 194 | 34873 | 35106 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 195 | 7081976 | 7082164 | - | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 196 | 2917127 | 2917378 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 197 | 4214581 | 4214778 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 198 | 224964 | 225158 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 199 | 10218 | 10418 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 200 | 1912138 | 1912374 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 201 | 3842574 | 3842807 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 202 | 163325 | 163549 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 203 | 5020321 | 5020560 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 204 | 425672 | 425902 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 205 | 88933 | 89169 | - | NZ_CP053989.1 | Niallia circulans |
| 206 | 2151324 | 2151551 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 207 | 1962588 | 1962821 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 208 | 4120968 | 4121162 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 209 | 328086 | 328334 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 210 | 384036 | 384266 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 211 | 363198 | 363440 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 212 | 361502 | 361744 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 213 | 1057456 | 1057674 | - | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 214 | 118812 | 119009 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 215 | 4028180 | 4028377 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 216 | 4102534 | 4102731 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 217 | 4198603 | 4198800 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 218 | 1467184 | 1467402 | - | NC_015696.1 | Francisella salina |
| 219 | 877239 | 877457 | - | NZ_CP043552.1 | Francisella marina |
| 220 | 422846 | 423076 | + | NZ_LT906470.1 | Veillonella rodentium |
| 221 | 360247 | 360477 | + | NZ_LR134375.1 | Veillonella dispar |
| 222 | 423421 | 423651 | + | NZ_LR778174.1 | Veillonella parvula |
| 223 | 10086 | 10307 | + | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 224 | 9894 | 10127 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 225 | 786145 | 786363 | + | NZ_CP022375.1 | Francisella opportunistica |
| 226 | 10036 | 10266 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 227 | 1162896 | 1163114 | - | NZ_CP022132.1 | Francisella halioticida |
| 228 | 4895259 | 4895495 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 229 | 1951873 | 1952112 | + | NZ_CP014161.1 | Aerococcus urinae |
| 230 | 3588927 | 3589160 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 231 | 1070293 | 1070511 | - | NC_017449.1 | Francisella hispaniensis |
| 232 | 66830 | 67057 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 233 | 417371 | 417616 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 234 | 1997797 | 1998042 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 235 | 124103 | 124348 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 236 | 10472 | 10705 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 237 | 2015527 | 2015751 | - | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 238 | 2328836 | 2329081 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 239 | 1775719 | 1775964 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 240 | 735459 | 735704 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 241 | 360785 | 361030 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 242 | 137576 | 137800 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 243 | 1415855 | 1416079 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 244 | 2276890 | 2277099 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 245 | 883225 | 883449 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 246 | 7195024 | 7195278 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 247 | 677115 | 677339 | - | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 248 | 871978 | 872220 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 249 | 2736989 | 2737198 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 250 | 24389 | 24613 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 251 | 4294103 | 4294300 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 252 | 729740 | 730003 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010003.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01250.19 | 0.95 | 239 | 537 | same-strand | Ribosomal protein S6 |
| 2 | PF00436.27 | 0.88 | 222 | 48.0 | same-strand | Single-strand binding protein family |
| 3 | PF01281.21 | 0.61 | 154 | 2334.0 | same-strand | Ribosomal protein L9, N-terminal domain |
| 4 | PF03948.16 | 0.61 | 154 | 2334.0 | same-strand | Ribosomal protein L9, C-terminal domain |
++ More..