Result : Q87HP7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0181 protein VPA0916 |
| NCBI Accession ID | BA000032.2 |
| Organism | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) |
| Left | 949336 |
| Right | 949494 |
| Strand | - |
| Nucleotide Sequence | ATGTTTGACGATTTACCACCTATATCGCACAAAGAGCAGCAAGAAGCTGTAGAACGAATTCAAGAATTGATGGCAAAGGGCACAAGTACAGCCGAAGCGATCAAAATCGTGGCAGACCAGATTCGCGCAGAATACGCAGCCAAACAACAAGGCAGTTAA |
| Sequence | MFDDLPPISHKEQQEAVERIQELMAKGTSTAEAIKIVADQIRAEYAAKQQGS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22520. Profile Description: Uncharacterized protein family (UPF0181). This family contains small proteins of about 50 amino acids of unknown function. The family includes YoaH. |
| Pubmed ID | 12620739 |
| Domain | CDD:419844 |
| Functional Category | Others |
| Uniprot ID | Q87HP7 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 63
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 643884 | 644042 | - | NZ_CP031782.1 | Vibrio parahaemolyticus |
| 2 | 2176061 | 2176216 | - | NZ_CP009468.1 | Vibrio harveyi |
| 3 | 835775 | 835930 | - | NZ_CP032094.1 | Vibrio alfacsensis |
| 4 | 1831252 | 1831407 | + | NZ_CP018311.1 | Vibrio rotiferianus |
| 5 | 1010735 | 1010890 | - | NZ_CP019960.1 | Vibrio owensii |
| 6 | 1352217 | 1352372 | + | NZ_CP025793.1 | Vibrio jasicida 090810c |
| 7 | 147775 | 147936 | + | NC_013457.1 | Vibrio antiquarius |
| 8 | 1721392 | 1721547 | - | NZ_CP030789.1 | Vibrio campbellii |
| 9 | 1284239 | 1284403 | + | NZ_CP009978.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 10 | 877524 | 877673 | + | NZ_CP009355.1 | Vibrio tubiashii ATCC 19109 |
| 11 | 540272 | 540427 | - | NZ_CP022742.1 | Vibrio qinghaiensis |
| 12 | 922748 | 922903 | + | NZ_CP044068.1 | Vibrio vulnificus |
| 13 | 611113 | 611256 | + | NZ_CP047476.1 | Vibrio astriarenae |
| 14 | 517374 | 517535 | + | NZ_AP014525.1 | Vibrio cholerae MS6 |
| 15 | 188233 | 188385 | + | NZ_CP045351.1 | Vibrio aquimaris |
| 16 | 1352584 | 1352736 | + | NZ_CP065151.1 | Vibrio kanaloae |
| 17 | 805040 | 805192 | + | NC_011744.2 | Vibrio atlanticus |
| 18 | 1542844 | 1542996 | + | NZ_CP039701.1 | Vibrio cyclitrophicus |
| 19 | 110358 | 110522 | - | NZ_CP046794.1 | Vibrio metschnikovii |
| 20 | 384522 | 384686 | - | NZ_CP035689.1 | Vibrio metoecus |
| 21 | 92050 | 92208 | + | NZ_CP040991.1 | Vibrio furnissii |
| 22 | 698336 | 698488 | - | NC_011313.1 | Aliivibrio salmonicida LFI1238 |
| 23 | 441304 | 441453 | + | NZ_AP018690.1 | Vibrio aphrogenes |
| 24 | 642062 | 642211 | + | NZ_AP019652.1 | Vibrio taketomensis |
| 25 | 232562 | 232720 | + | NZ_CP033077.1 | Vibrio zhugei |
| 26 | 2525035 | 2525214 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 27 | 2955563 | 2955742 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 28 | 862904 | 863053 | + | NZ_AP019658.1 | Vibrio ponticus |
| 29 | 603125 | 603271 | + | NZ_AP018686.1 | Vibrio rumoiensis |
| 30 | 266589 | 266738 | - | NZ_CP070625.1 | Photobacterium damselae subsp. damselae |
| 31 | 2976870 | 2977049 | - | NZ_CP029736.1 | Providencia rettgeri |
| 32 | 936588 | 936731 | - | NZ_AP014636.1 | Vibrio tritonius |
| 33 | 2035658 | 2035837 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 34 | 1955384 | 1955563 | + | NZ_LR134340.1 | Escherichia marmotae |
| 35 | 251732 | 251911 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 36 | 1894552 | 1894731 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 37 | 1827477 | 1827656 | - | NZ_AP014857.1 | Escherichia albertii |
| 38 | 2496518 | 2496697 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 39 | 2664773 | 2664952 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 40 | 1716049 | 1716228 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 41 | 4536833 | 4537012 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 42 | 546542 | 546721 | - | NZ_CP033744.1 | Citrobacter freundii |
| 43 | 4137933 | 4138112 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 44 | 4149009 | 4149188 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 45 | 2152838 | 2153011 | + | NZ_CP048796.1 | Providencia vermicola |
| 46 | 4431785 | 4431964 | - | NZ_CP053416.1 | Salmonella bongori |
| 47 | 1132470 | 1132649 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 48 | 1920903 | 1921082 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 49 | 2075434 | 2075607 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 50 | 1739356 | 1739508 | - | NZ_LT960612.1 | Vibrio tapetis subsp. tapetis |
| 51 | 3194686 | 3194865 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 52 | 2530842 | 2531024 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 53 | 964019 | 964195 | + | NZ_CP071326.1 | Photobacterium ganghwense |
| 54 | 1943566 | 1943748 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 55 | 1995973 | 1996149 | - | NZ_LS483470.1 | Leminorella richardii |
| 56 | 464759 | 464911 | - | NZ_CP014055.2 | Grimontia hollisae |
| 57 | 1012788 | 1012952 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 58 | 1716202 | 1716363 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 59 | 1909606 | 1909782 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 60 | 871202 | 871366 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 61 | 1105841 | 1105987 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 62 | 1864926 | 1865102 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 63 | 68021 | 68179 | + | NZ_CP040022.1 | Salinivibrio kushneri |
| 64 | 1574446 | 1574604 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
++ More..