Result : Q84F84
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphocarrier protein HPr (Histidine-containing protein) |
| NCBI Accession ID | AY211495.1 |
| Organism | Lysinibacillus sphaericus (Bacillus sphaericus) |
| Left | 2713 |
| Right | 2979 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACACAACAATTTACAGTAATCGATCCGTTAGGAATTCATGCTCGCCCGGCAAGCCAGCTTGTGGCAAAAGCTACACCATTCGCTTCCGCAATTGAAGTGCGTACTGAAGAAAAAGCAGCGAATTTAAAATCTATTCTTGGCGTAATGGGATTAGCTTTAAAGCAAGGTTCTCAATTTACACTATATGTAGAGGGGGAAGACGAAGATCAAGCATTTGAGGCATTAGCAACATTACTGACAGAAATGGGGCTTGCACAATGA |
| Sequence | MKTQQFTVIDPLGIHARPASQLVAKATPFASAIEVRTEEKAANLKSILGVMGLALKQGSQFTLYVEGEDEDQAFEALATLLTEMGLAQ |
| Source of smORF | Swiss-Prot |
| Function | General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain. {ECO:0000269|Pubmed:12855720}.; P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite-regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity (By similarity). {ECO:0000250}. |
| Pubmed ID | 12855720 |
| Domain | CDD:412221 |
| Functional Category | Others |
| Uniprot ID | Q84F84 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2899723 | 2899989 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 2 | 318175 | 318441 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 3 | 100721 | 100984 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 4 | 106300 | 106563 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 5 | 756950 | 757216 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 6 | 428831 | 429085 | - | NC_008010.2 | Deinococcus geothermalis DSM 11300 |
| 7 | 1071424 | 1071681 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
++ More..