Result : Q847R1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 |
| NCBI Accession ID | AY191288.1 |
| Organism | Aster yellows phytoplasma |
| Left | 450 |
| Right | 647 |
| Strand | + |
| Nucleotide Sequence | ATGAAATTAATTACTTATGTAAAAGAAGGAGAATCTATAGATAGAGTATTAAAAAAATGTAAACAAAAATTTGATAAAGCTCGTATAATAAGAAAATTACGTGAACGTCAACAATATATAAAACCTTCTGAAAGAAAAAGAAAAATTTTAGCAAAAGCTAAGTATAGAGAATTTAGAAAACTTCTAGCAGATGATTAA |
| Sequence | MKLITYVKEGESIDRVLKKCKQKFDKARIIRKLRERQQYIKPSERKRKILAKAKYREFRKLLADD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q847R1 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 104
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3361084 | 3361281 | + | NZ_CP015067.2 | Elizabethkingia anophelis |
| 2 | 3311770 | 3311967 | - | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 3 | 2378221 | 2378412 | + | NZ_CP011071.1 | Muricauda lutaonensis |
| 4 | 1797786 | 1797983 | + | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 5 | 1280066 | 1280263 | - | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 6 | 180266 | 180457 | - | NZ_CP013210.1 | Empedobacter brevis |
| 7 | 1846514 | 1846711 | - | NZ_LR134441.1 | Kaistella antarctica |
| 8 | 1218618 | 1218815 | + | NZ_CP034161.1 | Epilithonimonas vandammei |
| 9 | 3866721 | 3866918 | + | NZ_CP050995.1 | Chryseobacterium gallinarum |
| 10 | 3873196 | 3873393 | + | NZ_CP023049.2 | Chryseobacterium piperi |
| 11 | 542619 | 542816 | - | NZ_CP033932.1 | Chryseobacterium bernardetii |
| 12 | 2904291 | 2904488 | - | NZ_LR134289.1 | Chryseobacterium gleum |
| 13 | 2739377 | 2739571 | + | NZ_CP030104.1 | Flagellimonas maritima |
| 14 | 1557314 | 1557508 | + | NZ_CP032050.1 | Euzebyella marina |
| 15 | 2679888 | 2680085 | + | NZ_LR134503.1 | Kaistella jeonii |
| 16 | 3229635 | 3229829 | + | NZ_CP022957.1 | Maribacter cobaltidurans |
| 17 | 812776 | 812970 | - | NC_015844.1 | Zobellia galactanivorans |
| 18 | 2360621 | 2360815 | + | NC_015945.1 | Muricauda ruestringensis DSM 13258 |
| 19 | 79363 | 79557 | + | NZ_LR134404.1 | Weeksella virosa |
| 20 | 595843 | 596037 | - | NZ_CP022022.1 | Capnocytophaga endodontalis |
| 21 | 39938 | 40132 | - | NZ_CP020919.1 | Flavobacterium kingsejongi |
| 22 | 1513867 | 1514061 | + | NZ_CP006828.1 | Ornithobacterium rhinotracheale ORT-UMN 88 |
| 23 | 3026705 | 3026902 | + | NZ_LR215974.1 | Chryseobacterium taihuense |
| 24 | 542850 | 543047 | + | NZ_CP033914.1 | Chryseobacterium shandongense |
| 25 | 12250 | 12441 | + | NZ_CP053698.1 | Empedobacter stercoris |
| 26 | 1515314 | 1515508 | + | NZ_CP022379.1 | Capnocytophaga sputigena |
| 27 | 991220 | 991414 | + | NC_013162.1 | Capnocytophaga ochracea DSM 7271 |
| 28 | 548442 | 548636 | - | NZ_CP054494.1 | Flavobacterium columnare |
| 29 | 3287539 | 3287733 | - | NC_013222.1 | Robiginitalea biformata HTCC2501 |
| 30 | 4031810 | 4032007 | - | NZ_CP033929.1 | Chryseobacterium indoltheticum |
| 31 | 2170303 | 2170500 | - | NZ_CP022986.1 | Chryseobacterium camelliae |
| 32 | 526348 | 526542 | - | NZ_CP058595.1 | Costertonia aggregata |
| 33 | 1229946 | 1230137 | + | NZ_AP014564.1 | Ichthyobacterium seriolicida |
| 34 | 2820489 | 2820686 | + | NZ_CP034159.1 | Kaistella carnis |
| 35 | 2704505 | 2704702 | + | NZ_CP015199.1 | Chryseobacterium glaciei |
| 36 | 2066895 | 2067092 | + | NZ_CP033920.1 | Chryseobacterium carnipullorum |
| 37 | 2510017 | 2510211 | - | NZ_CP022386.1 | Capnocytophaga gingivalis |
| 38 | 326329 | 326520 | + | NZ_CP040908.1 | Empedobacter falsenii |
| 39 | 2604732 | 2604929 | - | NZ_CP033926.1 | Chryseobacterium joostei |
| 40 | 5111049 | 5111246 | - | NZ_LR134386.1 | Chryseobacterium nakagawai |
| 41 | 531611 | 531808 | - | NZ_CP033924.1 | Chryseobacterium lactis |
| 42 | 501548 | 501745 | - | NC_020510.1 | Blattabacterium cuenoti BPAA |
| 43 | 2751584 | 2751778 | + | NZ_CP016359.1 | Gramella flava JLT2011 |
| 44 | 125775 | 125966 | - | NZ_CP042831.1 | Flavobacterium alkalisoli |
| 45 | 2530378 | 2530572 | - | NC_008571.1 | Gramella forsetii KT0803 |
| 46 | 3055539 | 3055733 | - | NZ_CP015125.1 | Dokdonia donghaensis DSW-1 |
| 47 | 1409134 | 1409328 | - | NZ_CP018153.1 | Gramella salexigens |
| 48 | 2130289 | 2130483 | + | NZ_CP009976.1 | Cellulophaga baltica 18 |
| 49 | 2688960 | 2689154 | + | NC_014934.1 | Cellulophaga algicola DSM 14237 |
| 50 | 1981289 | 1981483 | + | NZ_CP029186.1 | Flavobacterium album |
| 51 | 177843 | 178037 | - | NZ_CP031188.1 | Flavobacterium arcticum |
| 52 | 1264167 | 1264361 | + | NC_014041.1 | Zunongwangia profunda SM-A87 |
| 53 | 1459847 | 1460041 | + | NZ_CP022378.1 | Capnocytophaga cynodegmi |
| 54 | 1305139 | 1305333 | - | NZ_CP022387.1 | Capnocytophaga stomatis |
| 55 | 505831 | 506028 | + | NZ_CP014224.1 | Wenyingzhuangia fucanilytica |
| 56 | 2148502 | 2148696 | + | NC_018013.1 | Aequorivita sublithincola DSM 14238 |
| 57 | 1609027 | 1609218 | - | NC_016599.1 | Owenweeksia hongkongensis DSM 17368 |
| 58 | 1329411 | 1329608 | + | NZ_LT899436.1 | Tenacibaculum jejuense |
| 59 | 1057796 | 1057987 | - | NZ_CP007451.1 | Draconibacterium orientale |
| 60 | 68093 | 68287 | + | NZ_CP034930.1 | Apibacter raozihei |
| 61 | 1559076 | 1559267 | - | NZ_CP028811.1 | Flavobacterium magnum |
| 62 | 43041 | 43235 | - | NC_014230.1 | Croceibacter atlanticus HTCC2559 |
| 63 | 109484 | 109678 | - | NZ_CP038810.1 | Flavobacterium sangjuense |
| 64 | 3520323 | 3520517 | + | NZ_CP040812.1 | Antarcticibacterium flavum |
| 65 | 2730935 | 2731129 | - | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 66 | 1063659 | 1063850 | + | NZ_CP041345.1 | Tenuifilum thalassicum |
| 67 | 51967 | 52161 | - | NZ_CP020918.1 | Flavobacterium faecale |
| 68 | 2350764 | 2350958 | + | NZ_CP029463.1 | Flavobacterium sediminis |
| 69 | 1459736 | 1459927 | + | NZ_CP069450.1 | Butyricimonas virosa |
| 70 | 1677654 | 1677848 | - | NZ_CP029187.1 | Flavobacterium pallidum |
| 71 | 2481637 | 2481831 | + | NZ_CP028136.1 | Gramella fulva |
| 72 | 591352 | 591546 | - | NC_015167.1 | Cellulophaga lytica DSM 7489 |
| 73 | 1769533 | 1769727 | - | NZ_CP042476.1 | Antarcticibacterium arcticum |
| 74 | 2295945 | 2296139 | - | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 75 | 705067 | 705264 | + | NZ_CP020822.1 | Tenacibaculum maritimum |
| 76 | 141451 | 141648 | + | NC_016621.1 | Blattabacterium sp. (Cryptocercus punctulatus) str. Cpu |
| 77 | 1989346 | 1989537 | + | NZ_CP039934.1 | Myroides fluvii |
| 78 | 2276571 | 2276765 | + | NZ_CP029255.1 | Flavobacterium crocinum |
| 79 | 3584928 | 3585122 | - | NZ_CP010817.1 | Myroides profundi |
| 80 | 2236841 | 2237035 | + | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 81 | 2002720 | 2002914 | - | NZ_CP019342.1 | Nonlabens tegetincola |
| 82 | 794294 | 794488 | - | NZ_CP016907.1 | Flavobacterium anhuiense |
| 83 | 600453 | 600647 | - | NZ_CP043612.1 | Flavobacterium nitrogenifigens |
| 84 | 3433958 | 3434155 | + | NZ_CP037933.1 | Flavobacterium nackdongense |
| 85 | 143896 | 144093 | + | NZ_CP029844.1 | Blattabacterium clevelandi |
| 86 | 2609865 | 2610059 | + | NZ_CP017774.1 | Flavobacterium commune |
| 87 | 1913083 | 1913280 | + | NZ_CP017479.1 | Flavobacterium gilvum |
| 88 | 141971 | 142162 | - | NZ_CP015402.2 | Muribaculum intestinale |
| 89 | 2245151 | 2245345 | + | NC_020156.1 | Nonlabens dokdonensis DSW-6 |
| 90 | 42385 | 42579 | - | NZ_CP017688.1 | Flavobacterium crassostreae |
| 91 | 1144452 | 1144646 | + | NZ_CP034549.1 | Nonlabens ponticola |
| 92 | 2419884 | 2420081 | + | NZ_CP019419.1 | Polaribacter reichenbachii |
| 93 | 187140 | 187331 | - | NZ_CP013195.1 | Prevotella enoeca |
| 94 | 4804237 | 4804431 | + | NZ_CP019288.1 | Kordia antarctica |
| 95 | 1351898 | 1352092 | - | NZ_CP012898.1 | Algibacter alginicilyticus |
| 96 | 1771370 | 1771561 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 97 | 2874088 | 2874279 | + | NZ_LR134384.1 | Prevotella oris |
| 98 | 1370740 | 1370937 | - | NZ_CP018155.1 | Tenacibaculum todarodis |
| 99 | 1011640 | 1011837 | - | NZ_CP013355.1 | Lutibacter profundi |
| 100 | 141540 | 141734 | - | NZ_CP007202.1 | Siansivirga zeaxanthinifaciens CC-SAMT-1 |
| 101 | 1424611 | 1424805 | - | NZ_CP025791.1 | Flavivirga eckloniae |
| 102 | 627793 | 627987 | - | NZ_CP039456.1 | Changchengzhania lutea |
| 103 | 4101231 | 4101428 | - | NZ_CP037755.1 | Pseudocnuella soli |
| 104 | 4367752 | 4367949 | - | NZ_CP032157.1 | Paraflavitalea soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015067.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 0.89 | 93 | 83.0 | same-strand | Phage integrase family |
| 2 | PF02899.19 | 0.89 | 93 | 83 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 3 | PF13495.8 | 0.86 | 89 | 82 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 4 | PF02482.21 | 0.87 | 90 | 1002.0 | same-strand | Sigma 54 modulation protein / S30EA ribosomal protein |
| 5 | PF00009.29 | 0.76 | 79 | 1945 | same-strand | Elongation factor Tu GTP binding domain |
| 6 | PF03143.19 | 0.74 | 77 | 1945 | same-strand | Elongation factor Tu C-terminal domain |
| 7 | PF03144.27 | 0.76 | 79 | 1945 | same-strand | Elongation factor Tu domain 2 |
| 8 | PF01926.25 | 0.75 | 78 | 1942.0 | same-strand | 50S ribosome-binding GTPase |
| 9 | PF00584.22 | 0.68 | 71 | 3318 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
| 10 | PF02357.21 | 0.66 | 69 | 3504 | same-strand | Transcription termination factor nusG |
| 11 | PF00467.31 | 0.66 | 69 | 3504 | same-strand | KOW motif |
++ More..