Result : A9BG00
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP000879.1 |
| Organism | Petrotoga mobilis (strain DSM 10674 / SJ95) |
| Left | 821271 |
| Right | 821456 |
| Strand | - |
| Nucleotide Sequence | ATGTCAAGTCTAAAGATAAAGTTAGTAAAAGGAAGAGCAGGGAAAGACAAAAGACAATTAGCTACTCTCGATGCTTTAGATTTAACTAGAAAAGATAAAGTAGTAATAAAACCTGACAATCCCCAAATTAGAGGAATGATAAGGACTGTACATCACTTAGTTGAGTGGGAAGAAATCGATTCTTAA |
| Sequence | MSSLKIKLVKGRAGKDKRQLATLDALDLTRKDKVVIKPDNPQIRGMIRTVHHLVEWEEIDS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A9BG00 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 821271 | 821456 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 2 | 867785 | 867970 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 3 | 1163450 | 1163632 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 4 | 3266622 | 3266804 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 5 | 150429 | 150608 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 6 | 1548068 | 1548229 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 7 | 570167 | 570349 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 8 | 2814396 | 2814575 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 9 | 472154 | 472342 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 10 | 2300503 | 2300682 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 11 | 2065163 | 2065345 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 12 | 569087 | 569263 | - | NZ_LR134476.1 | Trueperella bialowiezensis |
| 13 | 2015636 | 2015824 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 14 | 4175562 | 4175741 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 15 | 3815134 | 3815313 | - | NZ_CP009687.1 | Clostridium aceticum |
| 16 | 378559 | 378744 | + | NZ_CP011546.1 | Corynebacterium uterequi |
| 17 | 4068289 | 4068468 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 18 | 1289911 | 1290096 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 19 | 340783 | 340938 | + | NZ_LN879430.1 | Herbinix luporum |
| 20 | 394523 | 394702 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 21 | 1020133 | 1020312 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 22 | 903175 | 903354 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 23 | 1717187 | 1717372 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 24 | 3365306 | 3365488 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 25 | 5609639 | 5609821 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 26 | 450676 | 450852 | + | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 27 | 770110 | 770289 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 28 | 1466461 | 1466616 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 29 | 1244016 | 1244201 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 30 | 2131718 | 2131897 | - | NZ_CP029256.1 | Christensenella minuta |
| 31 | 4903434 | 4903616 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 32 | 4569404 | 4569583 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 33 | 617414 | 617605 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 34 | 610577 | 610768 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 35 | 2789681 | 2789836 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 36 | 1144142 | 1144318 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 37 | 4056304 | 4056459 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 38 | 114748 | 114933 | + | NZ_LT635455.1 | Olsenella timonensis |
| 39 | 1621222 | 1621404 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 40 | 3256893 | 3257069 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010003.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00557.26 | 0.93 | 37 | 2427 | same-strand | Metallopeptidase family M24 |
| 2 | PF00406.24 | 0.78 | 31 | 1799 | same-strand | Adenylate kinase |
| 3 | PF13207.8 | 0.78 | 31 | 1799 | same-strand | AAA domain |
| 4 | PF05191.16 | 0.7 | 28 | 1797.5 | same-strand | Adenylate kinase, active site lid |
| 5 | PF13238.8 | 0.6 | 24 | 1803.5 | same-strand | AAA domain |
| 6 | PF00344.22 | 0.97 | 39 | 465 | same-strand | SecY |
| 7 | PF00828.21 | 0.97 | 39 | 16 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00333.22 | 1.0 | 40 | 12.5 | same-strand | Ribosomal protein S5, N-terminal domain |
| 9 | PF03719.17 | 1.0 | 40 | 12.5 | same-strand | Ribosomal protein S5, C-terminal domain |
| 10 | PF00861.24 | 1.0 | 40 | 541.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 11 | PF00347.25 | 1.0 | 40 | 932.5 | same-strand | Ribosomal protein L6 |
| 12 | PF00410.21 | 1.0 | 40 | 1522.5 | same-strand | Ribosomal protein S8 |
| 13 | PF00253.23 | 0.9 | 36 | 1954.5 | same-strand | Ribosomal protein S14p/S29e |
++ More..