Result : Q83KJ8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin YefM |
| NCBI Accession ID | AE005674.2 |
| Organism | Shigella flexneri |
| Left | 2095787 |
| Right | 2096059 |
| Strand | - |
| Nucleotide Sequence | ATGCGTACAATTAGCTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGATCCTCATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAATTCGCTGGAAGAGACGGCTTATCTACTGCGTTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACGGAAAAGGACATTATTGAGTGGGTAATGCTGCCAACTTACTGA |
| Sequence | MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKDIIEWVMLPTY |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Antitoxin that counteracts the effect of the YoeB mRNA interferase. YefM binds to the promoter region of the yefM-yeoB operon to repress transcription, YeoB acts as a corepressor (By similarity). {ECO:0000250}. |
| Pubmed ID | 12384590 12704152 15718296 |
| Domain | CDD:415595 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | Q83KJ8 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 92
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2095787 | 2096059 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1077014 | 1077265 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 2089462 | 2089713 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4300181 | 4300432 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 5 | 4411397 | 4411648 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 6 | 4372077 | 4372328 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 7 | 3498239 | 3498490 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 8 | 500249 | 500500 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 9 | 2329325 | 2329576 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 10 | 27441 | 27692 | - | NZ_CP038855.1 | Pantoea vagans |
| 11 | 24300 | 24551 | - | NZ_CP045722.1 | Pantoea eucalypti |
| 12 | 864199 | 864450 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 13 | 298526 | 298777 | + | NC_017964.1 | Advenella kashmirensis WT001 |
| 14 | 327531 | 327782 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 15 | 3710138 | 3710389 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 16 | 1502540 | 1502791 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 17 | 787829 | 788086 | - | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 18 | 3032256 | 3032510 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 19 | 1320039 | 1320293 | - | NZ_CP059564.1 | Alysiella filiformis |
| 20 | 2765368 | 2765619 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 21 | 3662366 | 3662617 | - | NZ_LS483470.1 | Leminorella richardii |
| 22 | 3636616 | 3636867 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 23 | 1419050 | 1419316 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 24 | 5761073 | 5761324 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 25 | 1945211 | 1945462 | + | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 26 | 1733443 | 1733694 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 27 | 2596176 | 2596427 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 28 | 399661 | 399912 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 29 | 5103743 | 5103997 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 30 | 1148528 | 1148779 | + | NZ_LS483250.1 | Moritella yayanosii |
| 31 | 876172 | 876423 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 32 | 5164368 | 5164622 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 33 | 1174307 | 1174561 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 34 | 3914769 | 3915020 | - | NZ_CP061081.1 | Marinomonas arctica |
| 35 | 339523 | 339774 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 36 | 3060799 | 3061050 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 37 | 3787107 | 3787361 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 38 | 1962697 | 1962936 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 39 | 2558462 | 2558716 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 40 | 1008053 | 1008304 | - | NZ_CP048602.1 | Halomonas piezotolerans |
| 41 | 2228585 | 2228836 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 42 | 2106258 | 2106515 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 43 | 1468945 | 1469202 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 44 | 1682385 | 1682636 | + | NZ_CP017715.1 | Marinobacter salinus |
| 45 | 4912093 | 4912344 | + | NZ_CP059082.1 | Halomonas titanicae |
| 46 | 5368257 | 5368511 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 47 | 833823 | 834077 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 48 | 1131140 | 1131394 | + | NZ_CP047165.1 | Pelistega ratti |
| 49 | 938451 | 938702 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 50 | 2247908 | 2248159 | + | NZ_CP021358.1 | Kushneria marisflavi |
| 51 | 5245420 | 5245671 | + | NZ_CP011112.1 | Luteipulveratus mongoliensis |
| 52 | 172409 | 172660 | + | NZ_CP025682.1 | Azoarcus pumilus |
| 53 | 2206704 | 2206955 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 54 | 2335974 | 2336225 | - | NC_007912.1 | Saccharophagus degradans 2-40 |
| 55 | 989850 | 990101 | - | NC_021291.1 | Spiribacter salinus M19-40 |
| 56 | 1133068 | 1133319 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 57 | 620443 | 620697 | + | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 58 | 3682311 | 3682562 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 59 | 1062741 | 1063001 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 60 | 56736 | 56987 | - | NZ_CP029211.1 | Aquabacterium olei |
| 61 | 4492014 | 4492265 | - | NZ_CP036299.1 | Planctopirus ephydatiae |
| 62 | 1051226 | 1051477 | - | NZ_CP021323.1 | Kushneria konosiri |
| 63 | 350072 | 350329 | + | NZ_CP072793.1 | Thiothrix unzii |
| 64 | 343643 | 343900 | - | NC_012590.1 | Corynebacterium aurimucosum ATCC 700975 |
| 65 | 315423 | 315674 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 66 | 2234893 | 2235144 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 67 | 789462 | 789716 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 68 | 1343594 | 1343845 | + | NZ_CP029642.1 | Arthrobacter dokdonellae |
| 69 | 219219 | 219473 | + | NZ_AP014568.1 | Serpentinomonas raichei |
| 70 | 758588 | 758839 | - | NZ_AP022843.1 | Halomonas hydrothermalis |
| 71 | 468764 | 469015 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 72 | 1048646 | 1048897 | - | NZ_CP013341.1 | Nitrosomonas ureae |
| 73 | 2687556 | 2687807 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 74 | 2859417 | 2859671 | + | NZ_CP044331.1 | Methylocystis parvus |
| 75 | 1267719 | 1267973 | + | NZ_CP035299.1 | Corynebacterium pelargi |
| 76 | 113455 | 113712 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 77 | 3072099 | 3072353 | - | NZ_CP021425.1 | Oleiphilus messinensis |
| 78 | 1276204 | 1276458 | + | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 79 | 927436 | 927690 | + | NZ_LR134479.1 | Rothia aeria |
| 80 | 78835 | 79086 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 81 | 3246521 | 3246760 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 82 | 4206926 | 4207180 | + | NZ_LS483422.1 | Providencia heimbachae |
| 83 | 373154 | 373408 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 84 | 1997939 | 1998193 | + | NZ_LT906451.1 | Legionella lansingensis |
| 85 | 21344 | 21598 | + | NZ_CP048880.1 | Spartinivicinus ruber |
| 86 | 6040814 | 6041068 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 87 | 6037579 | 6037833 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 88 | 2515412 | 2515636 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 89 | 2488027 | 2488281 | - | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 90 | 1882368 | 1882622 | + | NC_014643.1 | Rothia dentocariosa ATCC 17931 |
| 91 | 3256063 | 3256308 | - | NZ_CP009571.1 | Sphingomonas taxi |
| 92 | 3175982 | 3176236 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 93 | 7111063 | 7111335 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 94 | 4447418 | 4447642 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 95 | 5598531 | 5598794 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 96 | 2438067 | 2438339 | - | NZ_CP032229.1 | Streptomyces seoulensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06769.16 | 0.89 | 82 | -3.0 | same-strand | YoeB-like toxin of bacterial type II toxin-antitoxin system |
++ More..