Result : Q83H58
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | BX251412.1 |
| Organism | Tropheryma whipplei (strain TW08/27) (Whipple's bacillus) |
| Left | 302126 |
| Right | 302404 |
| Strand | - |
| Nucleotide Sequence | ATGCTTAGAATCGTTCCTCGGAATATTTTTATTCTATTCATCATTGCTTATCGGAAAATTATTTCTCCCATGTATGGCCCTGTATGCAAGTATTACCCGTCCTGTTCCGAATATTGTCAAAATTCGATTGCAAATAACGGTGTCTTTCTTGGGGCAGCATACACATTTATGAGGCTCGTAAGGTGTAACCCGTGGTCGAAGGGTGGCGTTGATATGCCAAGGGTTAGTACGAAATACCGCGTTAATAAGTTTGGGTTCGCGTCTAGAAAAAATGTTTGA |
| Sequence | MLRIVPRNIFILFIIAYRKIISPMYGPVCKYYPSCSEYCQNSIANNGVFLGAAYTFMRLVRCNPWSKGGVDMPRVSTKYRVNKFGFASRKNV |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 12606174 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q83H58 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 926492 | 926770 | - | NC_004572.3 | Tropheryma whipplei str. Twist |
| 2 | 1423131 | 1423409 | - | NZ_CP040508.1 | Rhodoluna limnophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004572.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13614.8 | 1.0 | 2 | 3131.0 | same-strand | AAA domain |
| 2 | PF01656.25 | 1.0 | 2 | 3131.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF06564.14 | 1.0 | 2 | 3131.0 | same-strand | Cellulose biosynthesis protein BcsQ |
| 4 | PF02096.22 | 1.0 | 2 | -1.5 | same-strand | 60Kd inner membrane protein |
++ More..