ProsmORF-pred
Result : Q83G03
Protein Information
Information Type Description
Protein name 50S ribosomal protein L30
NCBI Accession ID AE014184.1
Organism Tropheryma whipplei (strain Twist) (Whipple's bacillus)
Left 640554
Right 640751
Strand -
Nucleotide Sequence GTGTTGGGGCTAGCAGTGACACGGCTTAGAATTACCCAGATTCGATCTTCAGTTGGTGAGAAGCAGAATAAGCGTGGCTCTCTTCGCAGTTTGCGCCTGAGACATGTTGGTGATACTGTCGACTGTGATGATACCCCTCAAGTGAGAGGGTACATCAGTGCATGCAGTCATCTTGTGAGAGTTGAGGAGATTCATTGA
Sequence MLGLAVTRLRITQIRSSVGEKQNKRGSLRSLRLRHVGDTVDCDDTPQVRGYISACSHLVRVEEIH
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7.
Pubmed ID 12902375
Domain CDD:412218
Functional Category Ribosomal_protein
Uniprot ID Q83G03
ORF Length (Amino Acid) 65
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 93
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 640554 640751 - NC_004572.3 Tropheryma whipplei str. Twist
2 1252557 1252742 - NZ_AP017457.1 Aurantimicrobium minutum
3 1378580 1378765 - NZ_CP049253.1 Microbacterium amylolyticum
4 996401 996568 + NZ_CP017146.1 Marisediminicola antarctica
5 951976 952158 + NZ_CP045572.1 Nonomuraea nitratireducens
6 872254 872421 - NZ_CP032630.1 Protaetiibacter intestinalis
7 635359 635556 + NC_014165.1 Thermobispora bispora DSM 43833
8 638828 639013 - NZ_CP035494.1 Microbacterium protaetiae
9 4465191 4465373 - NC_009380.1 Salinispora tropica CNB-440
10 226624 226809 + NZ_CP058670.1 Chryseoglobus indicus
11 2769612 2769797 - NZ_CP031425.1 Microbacterium foliorum
12 2542974 2543162 - NZ_CP031421.1 Microbacterium oleivorans
13 1536354 1536521 + NZ_CP035491.1 Agromyces protaetiae
14 654933 655100 + NZ_CP016076.1 Actinoalloteichus fjordicus
15 681012 681179 - NZ_CP061344.1 Microbacterium hominis
16 632761 632928 + NZ_CP022521.1 Actinoalloteichus hoggarensis
17 407569 407754 + NZ_CP064760.1 Microbacterium schleiferi
18 654826 655008 + NZ_CP023865.1 Actinoplanes teichomyceticus ATCC 31121
19 974441 974608 - NZ_CP049255.1 Microbacterium endophyticum
20 1220342 1220524 + NC_015635.1 Microlunatus phosphovorus NM-1
21 3061507 3061689 - NC_014830.1 Intrasporangium calvum DSM 43043
22 3067025 3067210 - NZ_CP031422.1 Microbacterium oxydans
23 579798 579965 + NZ_CP038266.1 Microbacterium wangchenii
24 1004285 1004458 + NC_022657.1 Actinoplanes friuliensis DSM 7358
25 2390193 2390360 - NZ_CP038256.1 Microbacterium sediminis
26 489224 489382 + NZ_CP031423.1 Microbacterium lemovicicum
27 2422800 2422967 - NZ_CP028913.1 Agromyces badenianii
28 555323 555490 + NZ_CP044232.1 Microbacterium lushaniae
29 648803 648985 + NZ_CP016353.1 Prauserella marina
30 2069714 2069896 - NZ_CP054938.1 Streptomyces harbinensis
31 4381490 4381672 + NZ_AP022871.1 Phytohabitans suffuscus
32 6587580 6587762 - NZ_CP058322.1 Micromonospora carbonacea
33 2918449 2918616 - NZ_CP018762.1 Microbacterium aurum
34 498401 498568 + NZ_CP044231.1 Microbacterium caowuchunii
35 2901252 2901434 - NZ_CP033724.1 Clavibacter michiganensis subsp. michiganensis
36 663636 663818 + NC_017093.1 Actinoplanes missouriensis 431
37 5777349 5777555 - NC_015312.1 Pseudonocardia dioxanivorans CB1190
38 2187416 2187598 - NC_022438.1 Leifsonia xyli subsp. cynodontis DSM 46306
39 4219135 4219317 + NZ_CP061725.1 Micromonospora craniellae
40 4903434 4903616 - NC_013510.1 Thermomonospora curvata DSM 43183
41 3411220 3411387 - NZ_CP013979.1 Agromyces aureus
42 1025913 1026089 + NZ_CP049933.1 Leucobacter coleopterorum
43 6224054 6224230 - NZ_AP018920.1 Pseudonocardia autotrophica
44 10397600 10397770 - NZ_CP034550.1 Saccharothrix syringae
45 1579418 1579600 - NC_009664.2 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
46 1029405 1029587 - NZ_CP032624.1 Gryllotalpicola protaetiae
47 1090732 1090914 + NC_013131.1 Catenulispora acidiphila DSM 44928
48 428095 428277 + NZ_CP060789.1 Tessaracoccus defluvii
49 407481 407663 + NC_013159.1 Saccharomonospora viridis DSM 43017
50 1873489 1873653 - NZ_CP046883.1 Corynebacterium anserum
51 2404903 2405076 - NZ_CP026949.1 Mycetocola zhujimingii
52 869273 869467 - NZ_CP060716.1 Leucobacter denitrificans
53 2148677 2148859 - NZ_LR134442.1 Propionibacterium australiense
54 3277335 3277517 - NZ_CP047180.1 Rathayibacter festucae
55 8746965 8747126 - NC_019673.1 Saccharothrix espanaensis DSM 44229
56 326138 326320 + NZ_CP028129.1 Rathayibacter rathayi
57 1169214 1169399 + NC_008278.1 Frankia alni ACN14a
58 652433 652615 + NZ_CP015515.1 Rathayibacter tritici
59 607894 608076 - NZ_CP019607.1 Tessaracoccus flavescens
60 3460738 3460920 + NZ_CP030033.1 Cryobacterium soli
61 3270682 3270864 - NZ_CP016282.1 Cryobacterium arcticum
62 5770418 5770594 - NZ_CP022753.1 Nocardiopsis gilva YIM 90087
63 3264242 3264418 + NZ_CP049863.1 Leucobacter viscericola
64 1338178 1338354 + NZ_CP049934.1 Leucobacter insecticola
65 2311915 2312097 + NZ_CP033719.1 Propionibacterium acidifaciens
66 689230 689400 + NC_021252.1 Amycolatopsis keratiniphila
67 11099123 11099308 - NZ_CP012752.1 Kibdelosporangium phytohabitans
68 3492644 3492823 - NZ_CP071883.1 Curtobacterium flaccumfaciens pv. flaccumfaciens
69 5541635 5541799 - NZ_CP022088.2 Nocardia brasiliensis
70 2546643 2546825 - NZ_CP047186.1 Rathayibacter tanaceti
71 686773 686958 + NC_007777.1 Frankia casuarinae
72 7752507 7752677 - NZ_CP008953.1 Amycolatopsis japonica
73 5986100 5986279 - NZ_CP041695.1 Nocardia otitidiscaviarum
74 857683 857847 + NC_006361.1 Nocardia farcinica IFM 10152
75 877506 877694 - NZ_CP035806.1 Leucobacter triazinivorans
76 879328 879516 + NZ_CP035037.1 Leucobacter muris
77 971425 971598 + NZ_AP018164.1 Mycobacterium shigaense
78 1726965 1727147 + NZ_LT635457.1 Actinomyces pacaensis
79 2643604 2643786 + NZ_LR214441.1 Tessaracoccus lapidicaptus
80 301057 301224 + NZ_CP026923.1 Pontimonas salivibrio
81 4037508 4037687 - NZ_CP019066.1 Tsukamurella tyrosinosolvens
82 621863 622027 - NZ_CP009312.1 Lawsonella clevelandensis
83 1122031 1122213 + NC_013595.1 Streptosporangium roseum DSM 43021
84 5494139 5494321 + NZ_CP033972.1 Gordonia insulae
85 1007319 1007495 + NZ_LR130759.1 Mycobacterium basiliense
86 4267149 4267361 - NZ_CP029642.1 Arthrobacter dokdonellae
87 2719431 2719613 - NZ_CP015453.1 Dietzia psychralcaliphila
88 2981697 2981873 - NZ_AP022575.1 Mycobacterium shinjukuense
89 2573992 2574174 - NZ_CP015961.1 Dietzia timorensis
90 678364 678573 + NZ_CP056080.1 Rothia nasimurium
91 7130626 7130808 + NZ_CP031142.1 Saccharopolyspora pogona
92 368886 369071 + NZ_CP009248.1 Corynebacterium sphenisci DSM 44792
93 5209091 5209273 + NZ_CP023688.1 Streptomyces rimosus
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_AP017457.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00406.24 0.88 82 2027.0 same-strand Adenylate kinase
2 PF13207.8 0.88 82 2027.0 same-strand AAA domain
3 PF13238.8 0.81 75 2024 same-strand AAA domain
4 PF00344.22 0.89 83 705 same-strand SecY
5 PF00828.21 0.99 92 0.0 same-strand Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
6 PF00333.22 1.0 93 3 same-strand Ribosomal protein S5, N-terminal domain
7 PF03719.17 1.0 93 3 same-strand Ribosomal protein S5, C-terminal domain
8 PF00861.24 1.0 93 695 same-strand Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
9 PF00347.25 1.0 93 1078 same-strand Ribosomal protein L6
10 PF00410.21 1.0 93 1624 same-strand Ribosomal protein S8
11 PF00557.26 0.83 77 2693 same-strand Metallopeptidase family M24
12 PF13671.8 0.65 60 2035.5 same-strand AAA domain
++ More..