Result : A9BFX8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000879.1 |
| Organism | Petrotoga mobilis (strain DSM 10674 / SJ95) |
| Left | 803353 |
| Right | 803643 |
| Strand | - |
| Nucleotide Sequence | ATGGATTTAGCTACAATGCTTCAAAATTTAGTTACTGAAGGTGGTTCCATTGGATGGGGTTTATATTATTTAGGAAAGTTATTGGGAGCAGGAGTTGCAATGGGAATAGGAGCTATAGGTCCTGGTGTTGGAGAAGGTAACATTGGAGCTCATGCAATGGACGCTATGGCAAGACAACCAGAGATGAGCGGGAATTTAACAACGAGGATGTTATTGGCAATGGCGGTTACAGAGTCAACGGGGCTTTATTCTTTGGTTGTTGCCTTGATTTTGTTGTTTGTTCTTCCATGA |
| Sequence | MDLATMLQNLVTEGGSIGWGLYYLGKLLGAGVAMGIGAIGPGVGEGNIGAHAMDAMARQPEMSGNLTTRMLLAMAVTESTGLYSLVVALILLFVLP |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | A9BFX8 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 803353 | 803643 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 2 | 1657928 | 1658224 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 3 | 2366071 | 2366349 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 4 | 192818 | 193108 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 5 | 397744 | 397989 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 6 | 280117 | 280377 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 7 | 82065 | 82322 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 8 | 1221007 | 1221264 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 9 | 1200652 | 1200909 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 10 | 1211459 | 1211716 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 11 | 251891 | 252136 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 12 | 574517 | 574756 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 13 | 301264 | 301503 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 14 | 846169 | 846426 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 15 | 2366780 | 2367025 | + | NZ_LS974202.1 | Mesotoga infera |
| 16 | 165383 | 165643 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 17 | 156623 | 156883 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 18 | 1113873 | 1114118 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011232.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 1.0 | 18 | 1443 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 1.0 | 18 | 1443 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF00231.21 | 1.0 | 18 | 2586.0 | same-strand | ATP synthase |
| 4 | PF00306.29 | 1.0 | 18 | 1058.0 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 5 | PF00213.20 | 1.0 | 18 | 509.5 | same-strand | ATP synthase delta (OSCP) subunit |
| 6 | PF00430.20 | 1.0 | 18 | 23.5 | same-strand | ATP synthase B/B' CF(0) |
| 7 | PF00119.22 | 1.0 | 18 | 19.0 | same-strand | ATP synthase A chain |
| 8 | PF03899.17 | 0.61 | 11 | 875 | same-strand | ATP synthase I chain |
| 9 | PF09527.12 | 0.83 | 15 | 1152 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
| 10 | PF00476.22 | 0.67 | 12 | 1892.0 | same-strand | DNA polymerase family A |
| 11 | PF02739.18 | 0.67 | 12 | 1892.0 | same-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
| 12 | PF01612.22 | 0.67 | 12 | 1892.0 | same-strand | 3'-5' exonuclease |
| 13 | PF01367.22 | 0.67 | 12 | 1892.0 | same-strand | 5'-3' exonuclease, C-terminal SAM fold |
++ More..