Result : Q839T8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein EF_0064 |
| NCBI Accession ID | AE016830.1 |
| Organism | Enterococcus faecalis (strain ATCC 700802 / V583) |
| Left | 67223 |
| Right | 67447 |
| Strand | - |
| Nucleotide Sequence | ATGTTAGAGGTTTTAAAAAGAATTAATACGCTTGCACAAAAAGAGCGTGAACAAGGTTTAACATCTGAAGAACAAGCTCTTCGTGTCGATTTGCGACAAGAATATTTGCGGACCATTCGTGAACAATTCAATAAAACATTAATGGGCGTCACTATTTATGATCCTACTGGTGAAGATGTAACCCCAGAAAAATTAAAAGAAGAACAGCAGAAATATTTTGATTAA |
| Sequence | MLEVLKRINTLAQKEREQGLTSEEQALRVDLRQEYLRTIREQFNKTLMGVTIYDPTGEDVTPEKLKEEQQKYFD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional |
| Pubmed ID | 12663927 |
| Domain | CDD:413030 |
| Functional Category | Others |
| Uniprot ID | Q839T8 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4023749 | 4023976 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 2 | 1344322 | 1344552 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 3 | 1838359 | 1838586 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 4 | 2515902 | 2516129 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 5 | 2449028 | 2449240 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 6 | 3615458 | 3615670 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 7 | 427385 | 427600 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 8 | 5423220 | 5423447 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 9 | 2074438 | 2074689 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 10 | 2087038 | 2087235 | - | NZ_CP011937.1 | Bacillus velezensis |
| 11 | 1868599 | 1868796 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 12 | 1862335 | 1862526 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 13 | 4787194 | 4787391 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 14 | 2161956 | 2162189 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 3070188 | 3070418 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 16 | 2203257 | 2203490 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 17 | 1684599 | 1684835 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 18 | 16311 | 16541 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 19 | 1978744 | 1978977 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 20 | 2029330 | 2029563 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 21 | 1498392 | 1498628 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 22 | 2487225 | 2487461 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 23 | 3492837 | 3493067 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 24 | 1115233 | 1115451 | + | NZ_CP047361.1 | Macrococcus canis |
| 25 | 597020 | 597238 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 26 | 498938 | 499156 | + | NZ_LT906444.1 | Listeria welshimeri |
| 27 | 532334 | 532552 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 28 | 1908805 | 1909026 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 29 | 1264368 | 1264601 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 30 | 1405969 | 1406202 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 31 | 777328 | 777558 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 32 | 1839776 | 1839973 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 33 | 1785391 | 1785612 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 34 | 495884 | 496102 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 35 | 1883347 | 1883580 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 36 | 1827776 | 1828009 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 37 | 1919459 | 1919692 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 38 | 435794 | 436012 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 39 | 1231947 | 1232147 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 40 | 2032444 | 2032677 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 41 | 1056438 | 1056656 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 42 | 1846666 | 1846899 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 43 | 1900892 | 1901134 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 44 | 2006559 | 2006792 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 45 | 50702 | 50935 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 46 | 2769374 | 2769583 | - | NZ_CP016538.2 | Planococcus maritimus |
| 47 | 2791089 | 2791298 | - | NZ_CP059540.1 | Planococcus maritimus |
| 48 | 916368 | 916604 | - | NZ_LR134516.1 | Neisseria animaloris |
| 49 | 1881541 | 1881774 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 50 | 457052 | 457285 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 51 | 1822719 | 1822964 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 52 | 1299218 | 1299454 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 53 | 420743 | 420937 | - | NZ_CP059563.1 | Conchiformibius steedae |
| 54 | 292996 | 293247 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011361.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03672.15 | 0.64 | 34 | 2853.5 | same-strand | Uncharacterised protein family (UPF0154) |
| 2 | PF00456.23 | 0.64 | 34 | 159.0 | same-strand | Transketolase, thiamine diphosphate binding domain |
| 3 | PF02779.26 | 0.64 | 34 | 159.0 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 0.62 | 33 | 160 | same-strand | Transketolase, C-terminal domain |
| 5 | PF00717.25 | 0.66 | 35 | 1195 | opposite-strand | Peptidase S24-like |
| 6 | PF01726.18 | 0.66 | 35 | 1195 | opposite-strand | LexA DNA binding domain |
++ More..