Result : Q833N1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | AE016830.1 |
| Organism | Enterococcus faecalis (strain ATCC 700802 / V583) |
| Left | 1856283 |
| Right | 1856585 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAATCCGTTAATCGGCGGTGTTCGTTTTTATCAACGATTTATTTCTCCAGGATTGCCTGCACGTTGTCGCTATTACCCAACGTGTTCACAATATATGATTGATGCAATTCATACACATGGAAGTGTCAAAGGAACAACGATGGGGGTAGCACGGATTTTACGATGTCATCCTTTTGTTAAAGGCGGCATTGACTATGTTCCGTTGAAATTTCGCTTGACGAAAAATCCTGATGAGACCTATCATGGACCGTATACGTATCGAAGAAATAAGAAAACAGAAGTAGAAAAGGATGGATAA |
| Sequence | MKNPLIGGVRFYQRFISPGLPARCRYYPTCSQYMIDAIHTHGSVKGTTMGVARILRCHPFVKGGIDYVPLKFRLTKNPDETYHGPYTYRRNKKTEVEKDG |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 12663927 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q833N1 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 51
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1341865 | 1342125 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 2 | 1043418 | 1043705 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 3 | 1328762 | 1329046 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 4 | 175497 | 175775 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 5 | 2570221 | 2570496 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 6 | 772298 | 772594 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 7 | 852334 | 852630 | + | NZ_CP065211.1 | Enterococcus lactis |
| 8 | 1222540 | 1222833 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 9 | 1448478 | 1448747 | + | NZ_CP023011.2 | Enterococcus hirae |
| 10 | 839731 | 840012 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 11 | 2071332 | 2071607 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 12 | 784940 | 785206 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 13 | 1826790 | 1827077 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 14 | 1589945 | 1590256 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 15 | 1671813 | 1672106 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 16 | 780578 | 780871 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
| 17 | 1560572 | 1560865 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 18 | 839525 | 839797 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 19 | 1483225 | 1483500 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 20 | 297301 | 297561 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 21 | 1196497 | 1196739 | + | NZ_CP043405.1 | Streptococcus ratti |
| 22 | 645759 | 646055 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 23 | 1844050 | 1844325 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 24 | 1236120 | 1236386 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 25 | 425593 | 425865 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 26 | 1073873 | 1074166 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 27 | 42499 | 42762 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 28 | 669954 | 670211 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 29 | 17972 | 18247 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 30 | 1327810 | 1328076 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 31 | 1380993 | 1381247 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 32 | 1450420 | 1450662 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 33 | 1677235 | 1677513 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 34 | 1276783 | 1277043 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 35 | 1602930 | 1603196 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 36 | 1254872 | 1255120 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 37 | 587000 | 587254 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 38 | 1724196 | 1724462 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 39 | 1304813 | 1305070 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 40 | 1414213 | 1414470 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 41 | 308693 | 308953 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 42 | 1824513 | 1824755 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 43 | 533260 | 533505 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 44 | 1069595 | 1069843 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 45 | 1606752 | 1606994 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 46 | 683341 | 683598 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 47 | 932761 | 933003 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 48 | 2509297 | 2509545 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 49 | 626231 | 626518 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 50 | 1233219 | 1233470 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 51 | 4690685 | 4690942 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
++ More..