Result : Q831N9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0223 protein EF_2462 |
| NCBI Accession ID | AE016830.1 |
| Organism | Enterococcus faecalis (strain ATCC 700802 / V583) |
| Left | 2382775 |
| Right | 2383053 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGACTATCAATATCCATTAGATTTAGATTGGACGACAGAGGAAATGGTGATTGTCACTAATATGTGGACAGCAGTTGAGCAAGCCAACGAAACAGGCTTGCCTGTTGACAAATTTTTAACAACTTATCAACAATTTAAAACGGTCGTTAAAAGTATCGGCGAAGAAAAACGCTTAGGTCGTGAATTTGAAAATGCTTCAGGATATTCGTTATATCGTACGCTTCAACAAGCTAAAAAACAGGGAAGCGGTAAATTAAAGCTGGGGGATGATTAG |
| Sequence | MKDYQYPLDLDWTTEEMVIVTNMWTAVEQANETGLPVDKFLTTYQQFKTVVKSIGEEKRLGREFENASGYSLYRTLQQAKKQGSGKLKLGDD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 12663927 |
| Domain | CDD:420035 |
| Functional Category | Others |
| Uniprot ID | Q831N9 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1000840 | 1001118 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 2 | 1126205 | 1126480 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 3 | 1644433 | 1644708 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 4 | 1600736 | 1601011 | - | NZ_CP065211.1 | Enterococcus lactis |
| 5 | 1587630 | 1587905 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 6 | 2276091 | 2276366 | - | NZ_CP023011.2 | Enterococcus hirae |
| 7 | 1987347 | 1987619 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 8 | 2100378 | 2100653 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 9 | 1235949 | 1236224 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 10 | 1620694 | 1620969 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 11 | 1081440 | 1081709 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 12 | 1026316 | 1026558 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 13 | 1825110 | 1825337 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 14 | 991482 | 991760 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 15 | 1581109 | 1581387 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 16 | 1767795 | 1768073 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 17 | 1074699 | 1074923 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 18 | 1125407 | 1125631 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 19 | 751660 | 751890 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 20 | 1393448 | 1393726 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 21 | 1334098 | 1334346 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 22 | 2449526 | 2449753 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 23 | 2391751 | 2391987 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 24 | 449336 | 449617 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 25 | 1091981 | 1092229 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 26 | 1297804 | 1298028 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 27 | 1217486 | 1217734 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 28 | 1809104 | 1809376 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 29 | 1819907 | 1820185 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 30 | 496800 | 497027 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 31 | 1083080 | 1083358 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 32 | 713859 | 714098 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 33 | 450288 | 450557 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 34 | 1040076 | 1040357 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 35 | 519550 | 519822 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 36 | 586757 | 586981 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 37 | 1638239 | 1638463 | - | NZ_CP014164.1 | Aerococcus viridans |
| 38 | 792798 | 793025 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 39 | 261157 | 261408 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 40 | 1435730 | 1435981 | + | NZ_CP011150.1 | Bacillus altitudinis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP021874.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01926.25 | 0.6 | 24 | 957.5 | same-strand | 50S ribosome-binding GTPase |
| 2 | PF00459.27 | 0.93 | 37 | -3 | same-strand | Inositol monophosphatase family |
++ More..