Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | AE016830.1 |
Organism | Enterococcus faecalis (strain ATCC 700802 / V583) |
Left | 3003238 |
Right | 3003537 |
Strand | - |
Nucleotide Sequence | ATGTTAAAACCGTCAATTGACTCATTGTTAAAAGAAGTCCCTTCAAAATATTCTTTGGTTATTTTAGCAAGCAAACGTGCGCATGAATTAGATGAAGGCGTTCAACCAACCGTTGAATCCTTTGATTCTGTAAAAAGTGTAGGTCGTGCGTTAGAAGAAATTGAAGCAGGAACAGTGATCAGTGATCCAAATCCTGAAGAAAAACGCGAACGTCTACGCATTGAACGTGAAGAACGCAAACGCCAACGTGAACAAGAACAAAAAGAATTAGAAAACCGTTTACGTGACGAAAAAAATTAA |
Sequence | MLKPSIDSLLKEVPSKYSLVILASKRAHELDEGVQPTVESFDSVKSVGRALEEIEAGTVISDPNPEEKRERLRIEREERKRQREQEQKELENRLRDEKN |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 12663927 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | Q82ZD6 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2318506 | 2318808 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
2 | 2857077 | 2857379 | - | NZ_CP018061.1 | Enterococcus mundtii |
3 | 2489079 | 2489381 | - | NZ_CP023074.1 | Enterococcus thailandicus |
4 | 3360520 | 3360822 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
5 | 826203 | 826505 | + | NZ_CP023011.2 | Enterococcus hirae |
6 | 2487968 | 2488270 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
7 | 2540549 | 2540851 | - | NZ_CP065211.1 | Enterococcus lactis |
8 | 67409 | 67705 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
9 | 2208479 | 2208775 | - | NZ_LS483306.1 | Enterococcus cecorum |
10 | 258562 | 258864 | + | NZ_AP022822.1 | Enterococcus saigonensis |
11 | 610462 | 610767 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
12 | 862935 | 863240 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
13 | 152920 | 153228 | + | NZ_CP017267.1 | Vagococcus teuberi |
14 | 1448978 | 1449274 | - | NZ_CP039712.1 | Vagococcus zengguangii |
15 | 346684 | 346992 | + | NZ_CP060720.1 | Vagococcus carniphilus |
16 | 876461 | 876766 | - | NZ_CP049887.1 | Vagococcus hydrophili |
17 | 403425 | 403736 | + | NC_012924.1 | Streptococcus suis SC84 |
18 | 375249 | 375560 | + | NZ_AP018400.1 | Streptococcus ruminantium |
19 | 1383096 | 1383407 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
20 | 1409665 | 1409976 | - | NZ_LR134275.1 | Streptococcus vestibularis |
21 | 1916117 | 1916431 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00625.23 | 1.0 | 21 | 8 | same-strand | Guanylate kinase |
2 | PF13238.8 | 0.86 | 18 | 8.0 | same-strand | AAA domain |
3 | PF03755.15 | 0.62 | 13 | 1043 | same-strand | YicC-like family, N-terminal region |
4 | PF08340.13 | 0.62 | 13 | 1043 | same-strand | Domain of unknown function (DUF1732) |
5 | PF02229.18 | 0.76 | 16 | 1875.5 | same-strand | Transcriptional Coactivator p15 (PC4) |
6 | PF13672.8 | 0.86 | 18 | 5372.0 | same-strand | Protein phosphatase 2C |
7 | PF01189.19 | 0.95 | 20 | 4027.5 | same-strand | 16S rRNA methyltransferase RsmB/F |
8 | PF01029.20 | 0.95 | 20 | 4027.5 | same-strand | NusB family |
9 | PF00551.21 | 0.95 | 20 | 3086.5 | same-strand | Formyl transferase |
10 | PF02911.20 | 0.95 | 20 | 3086.5 | same-strand | Formyl transferase, C-terminal domain |
11 | PF01327.23 | 0.62 | 13 | 2613 | same-strand | Polypeptide deformylase |
12 | PF17764.3 | 0.95 | 20 | 187.0 | same-strand | 3'DNA-binding domain (3'BD) |
13 | PF18074.3 | 0.95 | 20 | 187.0 | same-strand | Primosomal protein N C-terminal domain |
14 | PF04851.17 | 0.95 | 20 | 187.0 | same-strand | Type III restriction enzyme, res subunit |
15 | PF00270.31 | 0.95 | 20 | 187.0 | same-strand | DEAD/DEAH box helicase |
16 | PF18319.3 | 0.95 | 20 | 187.0 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
17 | PF01734.24 | 0.67 | 14 | 2073.5 | same-strand | Patatin-like phospholipase |