Result : Q82X93
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein NE0395 |
| NCBI Accession ID | AL954747.1 |
| Organism | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) |
| Left | 447369 |
| Right | 447671 |
| Strand | + |
| Nucleotide Sequence | ATGAGCTGGTATAGCTTTGGCAACGATCGCAGTCTCTTGATATTGAAACTTTACGTTCAGCCAGGTGCCAGACAAACTGAAGCAGTTGGCATTTGCGGAGAAGAGCTGAAAATAAAACTGGCAGCTCTTCCTGTGGACGGAAAAGCGAATCGTGCGCTGACGGAATTTCTGGCGAAACGCTTTAATGTTCCCCGGAAGAACATCACGCTGAAGCGCGGCGAACAATCCCGGCATAAAGTTGTTGAAGTCTGTCAGTCATCCAATGGACCCGAGGTGTTATTCAGTGAAATGAGAGCTGAATAA |
| Sequence | MSWYSFGNDRSLLILKLYVQPGARQTEAVGICGEELKIKLAALPVDGKANRALTEFLAKRFNVPRKNITLKRGEQSRHKVVEVCQSSNGPEVLFSEMRAE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | 12700255 |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | Q82X93 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 447369 | 447671 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 2 | 2275040 | 2275339 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 3 | 488563 | 488862 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 4 | 1413092 | 1413391 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 5 | 1140591 | 1140908 | - | NZ_CP021106.3 | Nitrosospira lacus |
| 6 | 262465 | 262713 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 7 | 1169465 | 1169794 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 8 | 268065 | 268358 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 9 | 2718732 | 2719028 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 10 | 1030084 | 1030377 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 11 | 2653710 | 2654003 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 12 | 4024883 | 4025128 | - | NZ_CP047241.1 | Aquitalea denitrificans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004757.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14748.8 | 0.92 | 11 | 618 | same-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 2 | PF03807.19 | 0.92 | 11 | 626.0 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 3 | PF02325.19 | 0.92 | 11 | 0 | same-strand | YGGT family |
++ More..