Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0235 protein NE0395 |
NCBI Accession ID | AL954747.1 |
Organism | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) |
Left | 447369 |
Right | 447671 |
Strand | + |
Nucleotide Sequence | ATGAGCTGGTATAGCTTTGGCAACGATCGCAGTCTCTTGATATTGAAACTTTACGTTCAGCCAGGTGCCAGACAAACTGAAGCAGTTGGCATTTGCGGAGAAGAGCTGAAAATAAAACTGGCAGCTCTTCCTGTGGACGGAAAAGCGAATCGTGCGCTGACGGAATTTCTGGCGAAACGCTTTAATGTTCCCCGGAAGAACATCACGCTGAAGCGCGGCGAACAATCCCGGCATAAAGTTGTTGAAGTCTGTCAGTCATCCAATGGACCCGAGGTGTTATTCAGTGAAATGAGAGCTGAATAA |
Sequence | MSWYSFGNDRSLLILKLYVQPGARQTEAVGICGEELKIKLAALPVDGKANRALTEFLAKRFNVPRKNITLKRGEQSRHKVVEVCQSSNGPEVLFSEMRAE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
Pubmed ID | 12700255 |
Domain | CDD:412584 |
Functional Category | Others |
Uniprot ID | Q82X93 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 447369 | 447671 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
2 | 2275040 | 2275339 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
3 | 488563 | 488862 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
4 | 1413092 | 1413391 | - | NZ_CP011451.1 | Nitrosomonas communis |
5 | 1140591 | 1140908 | - | NZ_CP021106.3 | Nitrosospira lacus |
6 | 262465 | 262713 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
7 | 1169465 | 1169794 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
8 | 268065 | 268358 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
9 | 2718732 | 2719028 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
10 | 1030084 | 1030377 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
11 | 2653710 | 2654003 | + | NZ_CP059467.1 | Aromatoleum bremense |
12 | 4024883 | 4025128 | - | NZ_CP047241.1 | Aquitalea denitrificans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14748.8 | 0.92 | 11 | 618 | same-strand | Pyrroline-5-carboxylate reductase dimerisation |
2 | PF03807.19 | 0.92 | 11 | 626.0 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
3 | PF02325.19 | 0.92 | 11 | 0 | same-strand | YGGT family |